KEGG   Sorghum bicolor (sorghum): SORBI_03g011670Help
Entry
SORBI_03g011670   CDS       T01086                                 

Gene name
SORBIDRAFT_03g011670, Sb03g011670
Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sbi00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 536 aa AA seqDB search
MVAAAAMATAASAAAPLLNGTRRPARLRRRGLRVRCAAVAGGAAEAPASTGARLSADCVV
VGGGISGLCTAQALATRHGVGEVLVTEARARPGGNITTVERPEEGYLWEEGPNSFQPSDP
VLSMAVDSGLKDDLVFGDPNAPRFVLWEGKLRPVPSKPADLPFFDLMSIPGKLRAGLGAL
GIRPPPPGREESVEEFVRRNLGAEVFERLIEPFCSGVYAGDPSKLSMKAAFGKVWRLEEA
GGSIIGGTIKTIQERGKNPKPPRDPRLPKPKGQTVASFRKGLAMLPNAITSSLGSKVKLS
WKLTSITKSDGKGYVLEYETPEGVVLVQAKSVIMTIPSYVASDILRPLSGDAADALSRFY
YPPVAAVTVSYPKEAIRKECLIDGELQGFGQLHPRSQGVETLGTIYSSSLFPNRAPAGRV
LLLNYIGGATNTGIVSKTESELVEAVDRDLRKMLINSTAVDPLVLGVRVWPQAIPQFLVG
HLDLLEVAKSALDQGGYDGLFLGGNYVAGVALGRCIEGAYESAAQIYDFLTKYAYK
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgccgccgccatggccaccgctgcatcggcggccgcgccgctactcaacggg
acccgaaggcctgcgaggctccgccgtcgcggactccgcgtgcgctgcgccgctgtggcg
ggcggcgcggccgaggcaccggcctccaccggcgcgcggctgtccgcggactgcgtcgtg
gtgggcggcgggatcagtggcctctgcaccgcgcaggcgctggccacgcggcacggcgtc
ggggaggtgcttgtcacggaggcccgcgcccgacccggcggcaacatcaccaccgtcgag
cgccccgaggaagggtacctctgggaggagggtcccaacagcttccagccatccgacccc
gttctctccatggccgtggacagcgggctgaaggatgacctggtttttggggatcccaac
gcgccgcggttcgtgctgtgggaggggaagctgaggcccgtgccatccaagcccgccgac
ctcccgttcttcgatctcatgagcatccctggcaagctcagggccggtctcggcgcgctt
ggcatccgcccgcctcctccaggccgcgaggagtcagtggaggagtttgtgcgccgcaac
ctcggtgctgaggtctttgagcgcctaattgagcctttctgctcaggtgtctatgctggt
gatccttccaagctcagtatgaaggctgcatttgggaaggtgtggcggttagaagaagct
ggaggtagtattattggtggaaccatcaagacgattcaggagagaggcaagaatccaaaa
ccaccgagggatccccgccttccgaagccaaaagggcagacagttgcatctttcaggaag
ggtcttgccatgcttccaaatgccatcacatccagcttgggtagtaaagtcaaactatca
tggaaactcacgagcattacaaaatcagatggcaaggggtatgttttggagtatgaaaca
ccagaaggggttgttttggtgcaggctaaaagtgttatcatgaccattccatcatatgtt
gctagcgacattttgcgtccactttcaggtgatgctgcagatgctctatcaagattctat
tatccaccagttgctgctgtaacggtttcgtatccaaaggaagcaattagaaaagaatgc
ttaattgatggggaactccagggttttggccagttgcatccacgtagtcaaggagttgag
acattaggaacaatatacagctcatcactctttccaaatcgtgctcctgctggtagggtg
ttacttctaaactacataggaggtgctacaaacacaggaattgtttccaagactgaaagt
gagctggtagaagcagttgaccgtgacctccgaaaaatgcttataaattctacagcagtg
gaccctttagtccttggtgtccgagtttggccacaagccatacctcagttcctggtagga
catcttgatcttctggaggtcgcaaaatctgccctggaccaaggtggctatgatgggctg
ttcctaggagggaactatgttgcaggagttgccctgggcagatgcattgagggcgcatat
gagagtgccgcacaaatatatgacttcttgaccaagtatgcctacaagtga

DBGET integrated database retrieval system