KEGG   Sorghum bicolor (sorghum): SORBI_03g012700Help
Entry
SORBI_03g012700   CDS       T01086                                 

Gene name
SORBIDRAFT_03g012700, Sb03g012700
Definition
hypothetical protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SORBI_03g012700 (SORBIDRAFT_03g012700)
Enzymes [BR:sbi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SORBI_03g012700 (SORBIDRAFT_03g012700)
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SORBI_03g012700 (SORBIDRAFT_03g012700)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 615 aa AA seqDB search
MESFLACGPLSRRCAARPRTANASSALGPVWTDTAAAGSSPPCPAASEPASKGPSHPTIA
AARPSGRFGGSADGATVRASASASIKGRGSGCCQSRLERPRKVRASGDLRVSDLTHPPRS
LTRASRHVVPFKARLSTQCSLEGRSVDQEIVIAMGSNVGDRVSTFNRALQLMKSSGVNIT
RHACLYETAPAYVTDQPRFLNSAIRGTTRLGPHELLKMLKEIEKGIGRTGGIRYGPRPID
LDILLYGNSEINSETLIVPHERIHERSFVLAPLVDLLGASGDDGIETSWHSLSKCSGGFF
ELWNKLGGESMIGTESIKRVLPVGDRLLDWCERTLVMGVLNLTPDSFSDGGKFQQVEAAI
SQAKLLISEGADIIDIGAQSTRPFAKRLSPNEELERLVPVLDVITKIPEMEGKLISVDTF
YAEVASEAVKRGAHMINDVSGGQLDPRIFKVAAELGVPYVAMHMRGDPSTMQSEQNLQYD
NVCKEVALELYTQVREAELSGIPLWRLVLDPGIGFSKKSGHNLEVIMGLESIRREMGKMS
IGASHVPILLGPSRKRFLGEICNRANPVERDVATVAAVTAGILNGANIVRVHNAGYGADA
AKVCDALRKGRSCKN
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgttccttgcttgcggcccgctatcaagaaggtgtgcggctcggcccagaaca
gcaaacgcctcctccgcactcggccccgtgtggacggacacagccgcagccggcagttcg
ccgccttgccctgctgcgagcgagcctgcgagcaaagggccctcccacccaaccatcgcc
gccgcacgtccgagtggacgctttgggggctccgccgacggcgccacggtacgtgcctcc
gcctctgcttccatcaaaggcaggggcagcggctgctgccagtcgagacttgagaggccg
aggaaggtccgagcatcgggagatcttcgggtgtctgatcttactcatcctccaagatcc
ttgaccagagcttccagacatgttgttccattcaaggcccgtttgtctacgcaatgctca
cttgagggccgttcagttgaccaagagattgtgattgctatgggaagtaatgtgggtgat
agagtcagtacattcaacagggcattgcagctgatgaaaagctcaggcgtgaacatcact
aggcatgcctgtctttatgagactgcccctgcttatgtgactgatcagccacggtttctt
aactctgccattcggggcacaactaggctcgggccacatgagcttcttaaaatgctaaaa
gaaattgagaagggtattggacgcactggtggaataaggtatggcccgagacctatcgat
ctagacatacttctttatggtaactccgagattaatagtgagactctaattgtgccacat
gagcgcatccatgagaggtcatttgttttagcacctcttgttgaccttctaggtgcatct
ggtgacgatggtattgaaacaagttggcactctctctcaaagtgcagtggcggtttcttt
gaattatggaataaacttgggggtgagtctatgattggaacagaaagcattaaaagggta
ttacctgttggggatcgtttgttggattggtgcgagaggacccttgtcatgggggtcctt
aatttgacaccagacagctttagtgatggaggtaagtttcaacaagtggaagctgccatt
tctcaggctaagttattaatctcagaaggtgcagatatcattgatattggtgctcaatct
accaggccctttgcaaagagattatctccaaacgaggagcttgagaggttggttcctgtt
ctggatgtgattacaaaaattcctgagatggagggcaagttaatctcagtggatacattc
tatgcagaagttgccagtgaagctgtgaaaagaggagctcacatgatcaacgatgtatcc
ggtggacagcttgatccaagaatttttaaagttgcagctgaactgggagttccatatgtt
gcaatgcacatgaggggagatccgtcaactatgcaaagcgaacaaaatttacagtatgat
aatgtctgcaaggaagttgctttggagctatacacacaggtgagagaagcagagttatct
gggattccattgtggaggttagttcttgatcctggcattggcttctccaagaaatctgga
cataaccttgaagtaattatgggattggaatccattaggagggagatgggaaaaatgagt
ataggtgcttcacatgtgccaatattactgggaccttcaaggaaaagatttttgggcgaa
atatgcaatcgtgccaatccagttgagagagatgttgctactgttgcagctgtgacagct
ggaattttgaatggtgccaacatagtaagggtccataatgctggatatggtgcagatgct
gcaaaggtttgtgatgcattgcgtaagggaagaagttgcaaaaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system