KEGG   Sorghum bicolor (sorghum): SORBI_03g013600Help
Entry
SORBI_03g013600   CDS       T01086                                 

Gene name
SORBIDRAFT_03g013600, Sb03g013600
Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    SORBI_03g013600 (SORBIDRAFT_03g013600)
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SORBI_03g013600 (SORBIDRAFT_03g013600)
Peptidases [BR:sbi01002]
 Metallo Peptidases
  Family M67
   SORBI_03g013600 (SORBIDRAFT_03g013600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 507 aa AA seqDB search
MGPPQPARVGAINIEACARPIAVDHRIRLPYYFRIAGSLLRQANIYRNESNFLDLYVILL
RYSSLLCETIPKHRDYHAFKLKEKAFFDKLNDVMKELETLKPVVQRQVAEHNRGGTVESN
TNSLNGNYGITRRIEQRTPTSYTPQPFVGSTNGALQKTFHAGRQVALLPSVQKQFMNLPY
PKEETLARHSILGPNGLNGRWNGPVTEIKVQYPSNFELTQNDITSLVPSILNQDDSHGPS
TAPAPPPPDSSSNDNDDMKSVLSLDDGRWSVPAERTPLPSASLEEELFQLDIKQPSPPPV
LAEVQRPISPSRVADPTPGLPTSGTARFQNLHVPIKLMECFLRVAESNTKRSLETCGVLA
GTLKKRTFCVTTLIIPKQKSTSNTCEAINEEELFEVQDTGSLFTLGWIHTHPTQSCFLSS
IDLHNHYSYQVMLPEAIAIVMAPTDTTRKHGIFHLTDPGGMGVIHDCQERGFHPHKAPLD
GSPIYEQCSHVYMDNDIKFDMIDLRER
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggggccaccgcagccagccagggtcggcgccatcaacatcgaggcgtgcgcgcggccg
atcgccgtcgaccaccgcatcaggctcccctactacttccgcatcgcgggcagcctcctc
cgacaggctaatatatatcggaacgagagtaacttcctcgacctgtatgtcatccttctg
agatactcgagcttgctgtgtgagacgattccgaagcatcgtgattaccatgccttcaag
ttaaaagaaaaggcattttttgataaacttaatgatgttatgaaagagcttgagacattg
aagccagttgtgcagcggcaggttgccgagcataacagaggaggtactgtggaatcgaat
actaatagtctaaatggaaactatggtataactcgtaggatagagcagcgcactccaacc
tcttatactccacagccatttgtaggcagcactaatggagcattgcaaaaaaccttccat
gctgggagacaagtggcattattaccaagcgtccagaaacaatttatgaatctaccatat
ccaaaagaagaaacactagctagacactccatattaggacctaatggtcttaatggccga
tggaatgggcctgttactgaaattaaggttcagtatccaagcaattttgaattaacacaa
aatgatataacaagtttagtgccatccatcttgaaccaagatgattcgcatggtcccagt
actgcacctgcacctccacctccagatagctcctcaaatgacaatgacgatatgaaatct
gttctctctcttgatgatggtcgatggtctgtgccagcagaacgcactccacttccttct
gctagcttggaagaagagttgtttcaattggatatcaaacaaccttctcctccaccagtt
ctggcagaggtgcaaagaccaatttctccatctagagttgctgatccaacacccggactt
ccgacctcaggaactgcccgttttcagaacttgcatgttccgatcaagttgatggagtgt
tttctaagggttgctgagtcaaacaccaaaagaagcttagaaacctgtggggttcttgct
ggtaccttgaaaaagagaactttttgcgtgacaaccttaattattccaaagcagaaatcg
acatctaatacgtgtgaagctataaatgaagaagagctatttgaagttcaggacacaggc
tcactgttcactcttggttggattcatacacatccaacacagtcctgcttcctttcttcc
attgacctccacaatcattattcttatcaggtcatgctacctgaagcaattgcgatagtt
atggcacctactgacacaacaagaaaacatggtatatttcatctcacggatccaggtggt
atgggcgtgatccatgattgtcaagagagaggtttccatcctcataaggcacctcttgat
ggttcgccaatctatgagcagtgctcccatgtgtacatggacaacgatataaagtttgat
atgattgatctccgagaacgatga

DBGET integrated database retrieval system