KEGG   Sorghum bicolor (sorghum): SORBI_03g013630Help
Entry
SORBI_03g013630   CDS       T01086                                 

Gene name
SORBIDRAFT_03g013630, Sb03g013630
Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:sbi04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 368 aa AA seqDB search
MAISQISRGTLSILLLLAAAFAAAPAALADGDDVVALTESTFEKEVGQDRGALVEFYAPW
CGHCKKLAPEYERLGASFKKAKSVLIAKIDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPK
KYEGQRTAEALAEFVNTEGGTNVKLATIPSSVVVLTPETFDSIVLDEAKDVLVEFYAPWC
GHCKSLAPTYEKVASVFKLDEGVVIANLDADKYRDLAEKYGVTGFPTLKFFPKGNKAGED
YDGGRDLGDFVKFINEKSGTSRDTKGQLTSEAGRIASLDVLAKEFLGASSDKRKEVLSSM
EEEAAKLSGPSARHGKVYVNIAKKILEKGNEYTKKETERLDRMLEKSINPSKADEFIIKK
NVLSTFSS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctcccagatctcacgcggaaccctgtccatcctcctcctcctggccgccgcc
ttcgctgctgccccggctgcgctcgcggacggcgacgacgtggtggccctcaccgagtcc
acgttcgagaaggaggtcggacaggaccgcggcgccctcgtcgagttctacgccccctgg
tgtggtcactgcaagaagcttgctcctgagtatgaaaggctgggtgcaagttttaagaaa
gctaaatctgtcttgattgctaagattgattgtgatgagcacaagagtttgtgcagtaag
tatggagtttccgggtatccaacaatccaatggttcccaaaaggatccttggagcccaaa
aagtatgaaggacaacgcactgcagaagcccttgctgaatttgttaatactgaaggaggc
acaaatgtaaagctggcaaccattccttcaagtgttgtggttctgaccccggagaccttt
gactcaattgtccttgatgaagccaaagatgtccttgttgagttctatgctccatggtgt
ggtcactgcaagagtcttgcaccgacatatgagaaggtggcttctgttttcaagttagat
gaaggagttgttattgctaaccttgatgctgacaaatacagggatttggctgagaagtat
ggagttactggatttcctacattgaagtttttcccaaagggaaacaaagctggtgaagat
tatgatggcggtagggacttgggtgactttgtcaagttcattaatgagaagagtggtacc
agccgtgacacaaagggtcaactaacctcagaggctggccgcatagcaagtctggatgtc
ctggctaaggagttccttggtgcttccagtgacaagcgaaaggaagtcctttccagtatg
gaggaggaggcagctaagctcagtggtccttctgcgaggcatgggaaggtctatgtaaac
atcgcaaagaagattctagagaaaggcaatgagtatactaagaaggaaaccgagaggctt
gatcgcatgttggagaagtccatcaacccctcgaaggccgatgagtttatcatcaagaag
aatgttctctcgactttctcatcctaa

DBGET integrated database retrieval system