KEGG   Sorghum bicolor (sorghum): SORBI_03g020630Help
Entry
SORBI_03g020630   CDS       T01086                                 

Gene name
SORBIDRAFT_03g020630, Sb03g020630
Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:sbi04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 513 aa AA seqDB search
MASGLSHGTSIESMARPVAVDHRISIHYYFRIADNLLRQANVYREEKNVLDLYIILLRYS
SLLLETIPKHRDYHAFKAREKEFLKKGPHNSEKILGVVNELESLKPVVQQQIATCNSRGA
DEPNGVYGTYAASSGLEHQTPDPYMSKSLAGSPTRLLQKPLPGSKHQAATSQSIQPYRHA
MKPPTNMLYPKEETLSRHSILGPNGLQGNLGQWTRPVTGIRIEYPHNPELTQSDISSLMP
TILNQDGLQGASTASQDKSDDMLSVLSLDDGRWSLPVEQASLSPGLVAEFSQLNIRQPSP
PPVLAQLHPEHGPIPPSRVADPRPGLATSETGRYQNLHVPVALMECFLSVAELNTAKNLE
TCGILAGTLKKRTFYVTTLIIPKQKSTSDSCQATNEEEIFEVQDKGSLLSLGWIHTHPTQ
TCFLSSIDLHNHYAYQIMLPEAIAIVMAPTDTTRKHGIFHLTEPCGMGVIHDCDATGFHP
HEEPLDGTPIYEHCSHVYMNPNVKFEMIDLREA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgggactatctcacgggactagcatcgagtccatggcgcggccggtcgccgtc
gaccaccgcatcagcatccactattacttccgcatcgctgacaacctcctccgccaggct
aatgtgtatcgagaagagaagaatgttctggacctctacatcatcctcctgagatactcg
agcttgttgcttgagaccatacccaaacatcgcgattaccatgcatttaaggccagagaa
aaggaattcctgaagaaaggcccacacaactctgagaaaattcttggtgtcgtcaatgag
ctagagtccctgaagccagttgtgcagcaacaaattgccacctgtaatagcaggggtgca
gatgaacctaatggtgtatatggaacctatgctgcaagtagtgggttggagcaccagacc
ccagacccatatatgtcaaagtcattggctggaagccctactagactactgcagaaaccg
ttacctggttcaaagcatcaagcagctacatcacagagtattcaaccttatagacatgct
atgaaaccacctaccaacatgctgtatccaaaagaggaaacgttatcaagacactcaata
ctaggacctaatgggcttcaggggaatctgggtcaatggacaaggcctgttactggtatc
aggattgagtatccacataatcctgaattaacccaaagtgacatttctagtttaatgcca
actatcttgaaccaagatggtttgcagggtgccagtacagcatctcaggacaaaagtgat
gatatgctttctgttctctcgcttgatgatggcaggtggtctttaccagtagaacaagcc
tcgttgtctcctggtttggttgcagagttttcccagctgaatattagacaaccttctccc
ccacctgtcctagctcaattgcatcctgagcatggaccaattcctccatcaagagttgct
gatccaagaccaggacttgctacctctgaaaccggacgctatcagaatttgcatgttcca
gtggcattaatggagtgtttcctgagcgtcgctgagttaaatactgcaaagaatttggaa
acctgtggaattctcgctggtactctgaaaaagagaaccttttacgtgacgacattgata
attcctaagcagaaatcaacatctgattcatgtcaagctacaaatgaagaagaaatattt
gaagttcaggacaaaggctcccttttgtctcttggttggattcatacacatccaacacag
acctgcttcctatcttccattgatcttcataatcattacgcatatcagattatgctacca
gaagcgattgcaatagttatggctcctacggatacaacaagaaaacatggcatatttcat
ctcacggagccatgtggcatgggcgtgatccatgattgtgatgcgactggattccaccct
catgaggagcccctagatgggacaccaatctatgagcattgctcccatgtatacatgaac
ccgaatgtgaagtttgagatgattgacctacgtgaagcatga

DBGET integrated database retrieval system