KEGG   Sorghum bicolor (sorghum): SORBI_03g025180Help
Entry
SORBI_03g025180   CDS       T01086                                 

Gene name
SORBIDRAFT_03g025180, Sb03g025180
Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SORBI_03g025180 (SORBIDRAFT_03g025180)
Peptidases [BR:sbi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SORBI_03g025180 (SORBIDRAFT_03g025180)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 477 aa AA seqDB search
MPTVSVKWQKEVFPGIEIDTSQPPIVFKSQLYTLTGVPPERQKIMVKGGILKDDADWSTL
GVKDGQKLMMIGTADEIVKAPEKGPVFVEDLPEEEQVVALGHSAGLYNLGNTCYMNSTLQ
CLHSVPELKSALLSYSDTVRGNGIDQASHNLTLATRNTFGDLDQSVRPVAPLQFLQTLRK
KYPQFAQQHNNVYMQQDAEECWTQLVYTLSQTLTSDSSESAVLPMKQLFGIDLVSRVHCA
ESGEESTETESVYSLKCHISQDVNHLHEGIKHGLKTELEKASPTLGRTAVYTRESRINEL
PRYLTVQFVRFFWKRESNQKAKILRKVDYPLELDVYEFCSDELKQKLQAPRQMLRDAENA
KFGLKAHGKASSSKENEESSSAGESSSMDIDKAESSLPKKQLTGVYDLVAVLTHKGRSAD
SGHYVGWVKQDDGKWIEFDDDNPNIRKEEDILKLSGGGDWHMAYICLYKARMAESKS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgtaagcgtgaaatggcagaaggaggtctttccaggcatagagattgacact
agccagcctcctattgttttcaagagtcagctgtacacactaactggtgtgccacctgaa
cgccaaaaaattatggtgaagggtggaatattgaaggatgatgcagattggtctactttg
ggagtgaaagacggccaaaagttgatgatgataggcacagctgatgagattgtgaaagct
ccagagaaaggtccagtgtttgttgaggatctgccagaagaagagcaagtggttgcactg
ggtcacagtgctggtctttataatcttgggaatacatgctatatgaattccacgttgcaa
tgtctgcattctgttccagagctgaagtcagcactgctaagctattcagatactgtaaga
ggtaatggcattgaccaagcttctcataatttgactcttgctactcggaatacctttggc
gatcttgatcaaagtgttcgccctgttgcacctctacaattcttgcagacactgcgtaaa
aaatacccgcaatttgcgcagcagcataataatgtctacatgcaacaggacgcagaagaa
tgctggacacagttggtgtatacactttctcaaactcttacctcagattcaagtgaatct
gcagttcttccgatgaagcaactatttgggatagatctcgtgagcagggtccactgtgca
gaaagtggtgaggagagcacggagacagaatcagtttattcccttaagtgtcatatatct
caagatgtgaaccatcttcatgagggaattaagcatggcttgaagacagaacttgagaaa
gcttcacctacactgggtcgaactgcagtttatactagagaatcaagaataaatgagctg
cctaggtacttgactgtgcagttcgttcgtttcttttggaaaagggaatcaaaccaaaag
gcaaagattttacgaaaagttgattacccactggaactggatgtttatgaattctgctct
gatgaactgaaacagaaactccaagctcctcggcagatgctgagagatgcagaaaatgca
aagttcggattgaaagcacatgggaaagctagcagctcaaaagaaaatgaggagtcaagt
agcgctggggaatcgtccagtatggacattgacaaagctgagtcttctctaccaaagaaa
caattaactggcgtctatgatttggttgctgtcttgacacacaagggaagaagtgcagac
tctggccactatgttggctgggttaagcaagatgacggaaaatggatcgagtttgatgat
gacaatccgaacattcgcaaggaggaagacattttgaaactatctggtggaggtgactgg
cacatggcttatatctgcctgtacaaagcccgcatggcggaatcaaagagttag

DBGET integrated database retrieval system