KEGG   Sorghum bicolor (sorghum): SORBI_03g026250Help
Entry
SORBI_03g026250   CDS       T01086                                 

Gene name
SORBIDRAFT_03g026250, Sb03g026250
Definition
(RefSeq) hypothetical protein
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     SORBI_03g026250 (SORBIDRAFT_03g026250)
Chromosome [BR:sbi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     SORBI_03g026250 (SORBIDRAFT_03g026250)
   HDAC complexes
    Sin3A-HDAC complex
     SORBI_03g026250 (SORBIDRAFT_03g026250)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    SORBI_03g026250 (SORBIDRAFT_03g026250)
  Chromatin remodeling factors
   NuRD complex
    SORBI_03g026250 (SORBIDRAFT_03g026250)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
Position
3
AA seq 492 aa AA seqDB search
MDTSGNSLPSPSCPDGKKREVCYYYDAGIASVDYGEDHSMVPRRVDMAHALVRSYGLLHD
MRRLRTRPATVTEITGDFHEPDYVRLLQNLTPESFYAGGATMSAAKAHNIGVLKEGETFY
DNPPIAGLWDYCQRYAGGSLAAARALGEGKADIAINWSGGMHHACKAAASGFCFVNDIVL
AIKDLLHHFRRVLYVDIDVHHGDGVETAFLDSNRVMTVSFHQRTKNFFPEERGHVNHVGE
GAGLYRALNVPFMEGVGDEGYCEMFKAIMKRVVDVFQPEAIVMQCGSDSLSGDRLGQLNL
SIAGHAQCVSYMRSFNLPLLLLGGGGYTVNHVAACWCYETAVAIGKEIDDNIPVHCYDTY
YSGQGYKLHYPVDKQLKNENKRSYLERTMTAVLENLSHLEAAPSVQFQDPPGPGGSGSTN
TEPLFYEQAPREDDDPMERLHRLCGERDERCFFRELGKKRQVAKDRENGGHHQTSRPEPV
KKYRHEKFHFKC
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggacacgagcggcaactcgctgccgtccccgtcgtgccccgacggcaagaagcgggag
gtgtgctactactacgacgccggcatcgccagcgtcgactacggcgaggaccacagcatg
gtgccccgccgagtcgacatggcgcacgcgctcgtccgctcctacggcctgctccacgac
atgaggcgtcttcgcacgaggcccgccaccgtcacggagattaccggagactttcatgag
cccgactacgttcgtttgctgcagaacctcaccccggagagcttctacgccggcggcgcc
accatgagcgcagcgaaggcgcacaatataggcgtgctcaaggaaggcgagactttctac
gacaaccctcccatcgccggcctctgggactactgccagcgctacgccggcgggtcgctg
gccgcggcgcgcgcgctcggcgaaggcaaagccgacatcgccatcaactggtccggcggc
atgcaccacgcgtgcaaagcggcggccagcggcttctgcttcgtcaacgacatcgtgctc
gccatcaaggacctcctccaccacttcaggcgcgtgctgtacgtcgacatcgacgtccac
cacggcgacggcgtcgagacggccttcctcgactccaaccgtgtgatgacagtgtcgttc
caccagcgcaccaagaatttcttcccggaggaaaggggacacgtcaaccacgtcggcgaa
ggggccggtctgtaccgtgctttgaacgtgccgttcatggagggcgtcggcgacgagggg
tactgcgagatgttcaaggccatcatgaaaagggtcgtcgacgtgttccagccggaggcc
atcgtgatgcagtgcggcagcgactcgctctccggcgacaggctcggccagcttaacctg
tccatcgccggccacgcccagtgcgtcagctacatgcggagcttcaacttgccgctgctc
cttctcggcggcggcggatacaccgtcaaccacgtcgccgcctgctggtgctacgagacg
gcggtggccatcggcaaggagatcgacgacaacataccggtgcactgctacgacacctac
tacagtggccaaggctacaagctccattacccggtggacaagcaactcaagaacgaaaac
aagagaagctacctagaacgcacgatgaccgcggtcctagagaacctctcccatctcgag
gcggcgccgagcgtgcagttccaggatccgcccgggcccggcggaagcggaagcaccaat
accgagccgctattctacgaacaggccccgcgagaagacgacgaccccatggagaggctg
catcggctttgtggcgagagggacgagcgctgcttcttcagagagttgggaaagaagcga
caggtagccaaggatagagaaaatggcggtcatcaccaaacgtctcggcccgaaccggtc
aaaaagtaccgacacgaaaagttccattttaaatgttga

DBGET integrated database retrieval system