KEGG   Sorghum bicolor (sorghum): SORBI_03g028880Help
Entry
SORBI_03g028880   CDS       T01086                                 

Gene name
SORBIDRAFT_03g028880, Sb03g028880
Definition
hypothetical protein
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    SORBI_03g028880 (SORBIDRAFT_03g028880)
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     SORBI_03g028880 (SORBIDRAFT_03g028880)
    1.1.1.234  flavanone 4-reductase
     SORBI_03g028880 (SORBIDRAFT_03g028880)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 350 aa AA seqDB search
MGEVVATWEATEGGAGVKGPVVVTGASGFLGSWLVMKLLQAGYTVRATVRDPANVVKTKP
LLDLPGATERLSLWKADLADEGSFDDAIRGCTGVFHVATPMDFESKDPENEVIKPTVEGM
MSIMRACKEAGTVRRIVFTSSAGTVNIEERQRPVYDQDNWSDVDFCQRVKMTGWMYFVSK
SLAEKAAMAYAAEHGLDFISIIPTLVVGPFLSAGMPPSLITALALVTGNEAHYSILKQVQ
FVHLDDLCDAHLFLFEHPAAAGRYVCSSHDATIHGLAAMLRDRYPEYDIPERFPGIEDDL
QPVHFSSKKLLDHGFTFKYTVEDMFDAAIRMCREKGLIPLATAGGGRALP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgggagaggtggtggcaacatgggaggcaacggagggaggcgcgggcgtgaaagggccg
gtggtggtcaccggggcgtcgggattcctcggctcctggctcgtcatgaagcttctccag
gccggctacaccgtccgggcgaccgtgcgcgatcccgcgaacgttgtgaagacgaagcca
ttgctggaccttcccggagcaacggagcgcctgtccctatggaaagccgacctggcggac
gaaggcagcttcgacgacgccatcaggggctgcaccggcgtcttccacgtcgccacgccc
atggacttcgagtccaaagaccctgagaacgaggtgatcaagccgacggtggaagggatg
atgagcatcatgcgagcctgcaaggaggccggcaccgtgcgccgcatcgtcttcacctcc
tccgccgggacggtcaacatcgaggagcggcagcggcccgtctacgaccaggacaactgg
agcgacgtcgatttctgccaacgcgtcaagatgacaggatggatgtacttcgtgtccaaa
tccctggcggagaaggcggccatggcgtacgcggcggagcacggcctggacttcatcagc
atcatcccgacgctcgtggtcggcccgttcctcagcgccggcatgccgcccagcctcatc
accgcgctggcgctcgtcacggggaacgaggcacactactcgatcctgaagcaggtgcag
ttcgtccacctcgacgacctctgcgacgcccatctcttcctcttcgagcacccggccgcc
gccggacgctacgtctgttcctcgcacgacgccaccatccacggcctcgccgccatgctc
agggataggtaccccgagtacgacatcccggagaggttccccgggattgaggacgacctc
cagcccgtgcacttctcgtccaagaagctcctagaccatggcttcactttcaagtacacg
gtggaggacatgttcgacgccgccatccgaatgtgccgggagaagggcctcatccccctc
gccacggccggaggggggagggctctgccttag

DBGET integrated database retrieval system