KEGG   Sorghum bicolor (sorghum): SORBI_03g028930Help
Entry
SORBI_03g028930   CDS       T01086                                 

Gene name
SORBIDRAFT_03g028930, Sb03g028930
Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SORBI_03g028930 (SORBIDRAFT_03g028930)
   00500 Starch and sucrose metabolism
    SORBI_03g028930 (SORBIDRAFT_03g028930)
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     SORBI_03g028930 (SORBIDRAFT_03g028930)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 301 aa AA seqDB search
MLTTGSRSRQLVLLVDQSGKGDHRRIQDAIDAAPAGGSGSGGGGVVIRIKPGVYRQVEKV
VVDKPCITLVGTSASSTIITWNESWVASESPTVSVLASDFIAKRLAFQNTFGSSGPAVAM
RVAGDRAAFYGCRFVSFQDTLLDDTGRHYYRGCYVQGATDFIFGNGKALFDKCHLHSVSA
AGGAFTAHKRWSESEDTGFSFVGCKLTGLGAGTSILGRPWGPYSRVVFALSYMSSTVRPQ
GWDDWTDGDKQRQRTAFYGQYQCYGEGSKTDGRVAWSHDMSQAQAAPFITKGWVGGQEWL
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgacgggctcgcggtcgcggcagctcgtcctcctggtcgaccagtccggcaaa
ggcgaccataggaggatccaggacgcgatcgatgcggcaccggcgggtggctccggcagc
ggcggcggcggcgtcgtcatccggatcaagccgggagtttacaggcaagtagagaaagtg
gtggtggacaagccttgcataactctcgtgggcacgagcgccagctcgaccatcatcacc
tggaacgagtcctgggtggcctccgagagcccgacagtatccgtgctagcctccgacttc
atcgccaagcgcttagcgttccagaacacgtttgggagtagcgggccggcagtcgccatg
agggtcgccggagacagggcggcgttctacgggtgcaggttcgtgtcgttccaggacacg
ctcctggacgacacgggccgccattactaccgcggctgctacgtccaaggtgccaccgac
ttcatcttcggcaatggcaaggctctgttcgataagtgccacctccactccgtgtcggcg
gccggcggcgcgttcacggcgcataaacggtggtcggagtcggaggacaccgggttcagt
ttcgtggggtgcaagctgacggggctcggggccggcacgtccatcctggggcgaccctgg
ggtccctactcccgcgtcgtcttcgcgctcagctacatgtccagcacggtgaggccccag
ggctgggacgactggaccgacggcgacaaacagaggcagaggacagcgttctacgggcag
taccagtgctacggggaaggctccaagactgacggaagagtagcgtggtctcacgacatg
tcgcaggctcaagctgcaccgttcatcaccaaaggttgggttggtggacaggagtggctt
cggtag

DBGET integrated database retrieval system