KEGG   Sorghum bicolor (sorghum): SORBI_03g028970Help
Entry
SORBI_03g028970   CDS       T01086                                 

Gene name
SORBIDRAFT_03g028970, Sb03g028970
Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:sbi03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 344 aa AA seqDB search
MATFGTAGASAANQNPNKSVEVTPAPGDSVSSLSFSPKANHLVSTSWDNQVLCWEVMAGG
ACQAKASISHDQPVLCSAWKDDGMTVFSGGCDKQVKMWPLLSGGQPTVFSGHEAPIKELA
WVPQMNLLVSGSWDKTLRYWDIRQPQPVHVQQLPDRCYALSLSYPLMVVGTADRNVVVFN
LQNPQAEFKRITSPLKLQTRCLAAFPDQQGFLIGSIEGRVGVHHVDDSQQGKNFTFKCHR
DGNDIYSVNSLNFHPVHGTFATTGSDGGFNFWDKDSKQRLKAFNKCPAPITCSTFNHDGS
IFAYAVCYDWSKGAEKHNPSAAKTNIFLHSVQESDVKGKPRGKK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccttcggtaccgccggcgccagcgccgccaaccagaaccccaacaaatccgtc
gaggtgactccggcgcccggggactcggtgtccagcctcagcttcagccccaaggcgaac
cacctcgtttcaacctcatgggacaaccaggttctgtgctgggaggtcatggctggtggg
gcatgccaagcgaaggcctccatttcgcacgatcaaccggtgctgtgctcggcttggaag
gatgatgggatgactgttttctcaggaggctgtgataagcaggttaaaatgtggcctctg
ctctcaggtggccagcccacggttttctcagggcatgaggcacctattaaagagctcgct
tgggtgccacagatgaatcttcttgtcagtgggagctgggacaagactttgaggtactgg
gacattaggcaaccccaaccagtgcatgttcagcaacttcctgaccgctgctatgctcta
tcgctttcttatcctctcatggtggttggcactgctgatcgcaacgtagtagtcttcaat
ctgcagaatccacaggctgaattcaagaggattacatcacctttgaagctccagacaagg
tgtcttgctgcatttcctgatcaacaaggttttttgattgggtcgatagaaggacgagtt
ggtgttcatcacgtggatgactctcagcaaggaaaaaacttcacattcaagtgtcaccgt
gatggcaatgatatatactctgttaactcattgaacttccatcctgtgcatggtacattc
gctactacaggctctgatggaggtttcaacttttgggacaaggacagtaagcaaaggctg
aaggcttttaataagtgtccagcacccatcacatgcagtacattcaatcatgatggctct
atatttgcttatgcggtatgctatgattggagcaagggtgctgagaagcataatccttct
gctgcaaagacaaatatctttctacatagtgtacaggaatctgatgtgaaaggaaagcct
cgtggaaagaagtag

DBGET integrated database retrieval system