KEGG   Sorghum bicolor (sorghum): SORBI_03g030040Help
Entry
SORBI_03g030040   CDS       T01086                                 

Gene name
SORBIDRAFT_03g030040, Sb03g030040
Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sbi00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 316 aa AA seqDB search
MSMGHCSEQRTGFEVTKDWNGADQVAIRSPRGASVRVCLHGGQVVSWRNHRGEELLFSSS
KAIFKPPKATRGGIPICFPQFGNCGTLEQHGFARNKIWTIDDEAPPLNSGDNNNNKASVD
LLLKPSEDDLKCWPHCFELRLRVSLSMDGDLSLISRVRNVNGKPFSFAFAYHTHLSVSDI
SEVRIEGLETLDYLDNLSQRERFTEQGDAITFESEVDRVYVGCPGVIAVLDHEKKRTFII
RKEGLPDIVVWNPWEKKSKTMTDFGDDEYKQMLCVDAAAVERTITLKPGEEWTGKLELSA
VASTNCSDHLDHPGRL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgggccattgctccgagcagcggacggggttcgaggtcaccaaggactggaac
ggcgccgaccaggtcgcgatccggtccccgcggggggcttccgtccgggtctgcctgcac
ggcgggcaggtcgtctcgtggaggaaccaccgcggcgaggagctcctcttcagcagtagc
aaggcaatcttcaagccgcccaaagcgacgcgtggtggcattccaatatgcttcccccag
tttggaaactgtggaacactggagcaacatggatttgcaaggaacaagatatggacaata
gatgatgaggctccaccactaaattctggtgataacaacaacaacaaagcttctgttgac
cttctgctaaagccatctgaagatgacctgaagtgctggccacactgtttcgagttacgt
ctcagagtttctctttcaatggatggagacctttcactgatatcacgggttaggaatgtt
aacgggaagccattcagttttgcatttgcttatcatacacacctttctgtttctgacatc
agtgaagtgaggatagaaggtctggagacccttgattatcttgacaaccttagccagcgg
gaacgttttactgaacagggagatgctataacatttgaatcagaggttgatcgagtctat
gttggctgcccaggcgtaatagctgttcttgaccatgaaaagaaacgcacattcatcatc
cgaaaagaaggccttcctgatattgttgtgtggaacccctgggaaaagaagtccaagacg
atgacagacttcggcgacgacgagtacaagcagatgctgtgcgtggatgcggccgcggtc
gagaggaccatcacgctgaagcccggcgaggagtggacggggaagctggagctctccgcc
gtggcgtcgaccaactgcagcgaccacctggatcacccgggcaggctgtag

DBGET integrated database retrieval system