KEGG   Sorghum bicolor (sorghum): SORBI_03g030470Help
Entry
SORBI_03g030470   CDS       T01086                                 

Gene name
SORBIDRAFT_03g030470, Sb03g030470
Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SORBI_03g030470 (SORBIDRAFT_03g030470)
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SORBI_03g030470 (SORBIDRAFT_03g030470)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 364 aa AA seqDB search
MAQARVRLTPAAYTPAAAFLSGSNPRPAHLTFFPKLTPTSISATAAANAPPPHIVVVGSA
NADIYVEVDRLPLIGETVAARAGRSLAGGKGANQAACGGRLALGPTYLVARVGDDANGRL
LEGALADAGGVRTDRVARAADAPSGHAVVMLMPDGQNSIIIVGGANMEGWAAGIGPEDLE
LIRKAGVLLLQREIPDWVNAQAAQAAKSAGVPVIMDAGGMDAPVPGELLSLVDIFSPNET
ELARLTGMPTETFEQISQAAGECHKMGVREVLVKLGSQGSALFVEGEEPIRQPIIPATEV
IDTTGAGDTFTSAFAVALVEGKPKEECMRFAAAAASLCVRVKGAIPSMPDRKSVMKLLDS
AKVE
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggcacgcgtgcgccttactccggccgcctacacgccggccgccgcgttcctc
tcgggctccaaccccagacccgcccacctcaccttcttcccgaagctcaccccgacctcc
atctccgcaaccgcggctgccaatgcgccgccgccccacatcgtcgtcgtgggctctgcc
aacgccgacatctacgtcgaggtcgaccgcctcccgctaatcggcgagaccgtggcggcc
cgcgcggggcgcagcctcgcgggcggcaagggcgccaaccaggccgcctgcggcggacgc
ctcgcgctgggtcctacctacctcgtggctcgcgtcggcgatgacgcaaacggccgactc
ctcgaaggtgccctagccgacgccggcggtgtccgcaccgaccgcgtcgcgcgcgcggcc
gatgcgccatcgggacacgccgtcgtcatgctcatgcccgacggccagaactccatcatc
atcgtgggcggggcgaacatggagggctgggcggcggggatcggcccggaggatctggaa
ttgatccgaaaggccggcgtactgctgctgcagagggagatacccgattgggtcaacgcg
caggctgcccaggctgcaaaaagtgccggagtgcctgttatcatggacgctggtggaatg
gatgcccctgtgcctggagaactactcagtctagtggatattttcagtccaaatgaaaca
gagctagcacgtttgactgggatgcctactgagacgtttgaacagatcagccaggctgca
ggagaatgccataaaatgggtgtgagagaagtactagttaaacttggatcacaaggatct
gctttgtttgttgagggagaggagccaatcaggcagccgataattcctgccacagaagtt
attgataccacgggggctggtgacactttcacctcagcatttgctgtagctctggttgag
gggaagcctaaggaggagtgcatgagatttgctgctgccgccgcctctctttgtgttcgt
gtaaagggtgctatacccagcatgcctgacagaaaatcagtaatgaagcttctggattct
gcgaaagtcgaataa

DBGET integrated database retrieval system