KEGG   Sorghum bicolor (sorghum): SORBI_03g031880Help
Entry
SORBI_03g031880   CDS       T01086                                 

Gene name
SORBIDRAFT_03g031880, Sb03g031880
Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sbi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sbi00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:sbi00750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 530 aa AA seqDB search
MATFTAASSLSLLFSHPNSHSRQPSVRGGPAAGSHLRLPPRASPSRARCASSDTTATKHR
RPAEENIREEAARLRGPAQGFSAWYEPFPPAPGGDPDERYSLDEVVYRSSSGGLLDVRHD
MEALARYPGSYWRDLFDSRVGRTAWPYGSGVWSKKEFVLPEIDSDHIVSLFEGNSNLFWA
ERLGREHLGGMNDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRRAPLSRPINGVGCASTG
DTSAALSAYCAAAGIPAIVFLPADRISLQQLIQPIANGATVLSLDTDFDGCMRLIREVTA
ELPIYLANSLNSLRLEGQKTAAIEILQQFNWQVPDWVIVPGGNLGNIYAFYKGFEMCRVL
GLVDRVPRLVCAQAANANPLYRYYKSGWTEFQPQVAETTYASAIQIGDPVSVDRAVVALK
ATNGIVEEATEEELMDATALADRTGMFACPHTGVALAALFKLRDQRIIGPNDRTVVVSTA
HGLKFTQSKIDYHDKNIKDMVCQYANPPISVKADFGSVMDVLQKNLNGKI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccttcaccgcggcctcctccctctccctcctcttctcccaccccaactcccac
tcccgccaaccatccgtgcgcggggggcccgccgccggctcccacctccgcctgcctccc
cgcgccagccccagccgcgcgcgctgcgcctcctccgacacgacggccacgaagcaccgc
cgcccagcggaggagaacatccgcgaggaggcggcgcggctccggggccccgcgcagggc
ttctcggcgtggtacgagcccttcccgccggcgcccggcggcgaccccgacgagcgctac
tcgctggacgaggtcgtctaccgctccagctcggggggcctcctcgacgtgcgccacgac
atggaggcgctggcgcgctacccgggctcctactggcgcgacctcttcgactcccgcgtc
ggccgcaccgcctggccctacggctcgggcgtctggtccaagaaggagttcgtgctcccc
gagatcgactccgaccacatcgtctccctcttcgagggcaactccaacctcttctgggcg
gagcgcctcggccgcgagcacctcggcgggatgaacgacctctgggtcaagcactgcggc
atctcccacacgggctccttcaaggacctcggcatgaccgtgctcgtcagtcaggtgaac
cgcctccgccgcgcgccgctctcgcgccccatcaacggtgtcggctgtgcgtccacggga
gacacctccgccgcgctctcggcctactgcgcggccgcgggaatccccgccatcgtgttc
ctgccagcggaccgcatctcgctgcagcagctcatccagccaatcgccaacggcgccacc
gtgctctctctagacactgattttgatggctgcatgcgactcattcgcgaggtgactgca
gagctgccaatctaccttgccaattcactcaactcgcttcgcctcgaggggcagaagaca
gcggccatcgagatattgcagcagttcaattggcaggtgccggattgggtcattgttcca
ggaggcaatcttgggaatatctatgcattctacaaggggtttgagatgtgccgcgttctt
ggccttgttgatcgtgtgccacggcttgtctgtgcacaggctgcaaatgcaaatccgttg
taccggtactacaagtcaggctggactgagtttcagccacaagttgctgaaactacatat
gcatctgcaatacagattggtgatcctgtatctgttgaccgtgcggtggtcgcgctgaag
gctaccaatggtattgtggaggaggctacagaggaggagctaatggatgcgacggctctt
gctgaccgcactgggatgtttgcttgcccacatactggggttgcacttgctgctttgttt
aagctccgggatcagcgtataattgggcctaatgaccgcactgtggttgttagcacagct
catgggctgaagttcacgcagtcaaagatcgactaccatgacaaaaacatcaaggacatg
gtttgccagtatgctaatccaccgatcagtgtgaaggctgactttggttctgtgatggat
gttctccagaaaaatctcaatggtaagatataa

DBGET integrated database retrieval system