KEGG   Sorghum bicolor (sorghum): SORBI_03g032950Help
Entry
SORBI_03g032950   CDS       T01086                                 

Gene name
SORBIDRAFT_03g032950, Sb03g032950
Definition
hypothetical protein
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SORBI_03g032950 (SORBIDRAFT_03g032950)
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     SORBI_03g032950 (SORBIDRAFT_03g032950)
    2.7.1.82  ethanolamine kinase
     SORBI_03g032950 (SORBIDRAFT_03g032950)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 369 aa AA seqDB search
MVAIENNQSQVQVAVAAEAVPVPVPGPRIPREARSLLHELAAAWADVADCRALEVVPLKG
AMTNEVYQVRWLTGPAAAGEKEEPRREREVRKVLVRIYGDGVDLFFDREDEVRTFECMSR
HGQGPRLLGRFPNGRVEEFIHARTLSAADLRDPEISALVASKLREFHNLDMPGPKSVLIW
DRLRNWLRTAKNLCPSEEAKEFRLDSLENEITALENECSGDYQWIGFCHNDLQYGNIMID
EETNVLTIIDFEYASFNPVAYDIANHFCEMAADYHSSKPHILDYSRYPDVDEQKRFVKTY
LNISGEEPDAEVVENLLQRIDKYMLASHLVWGLWGIISDHVNDIDFDYKEYARQRFEQYW
QKKSAILTS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgatcgagaacaaccagagccaggtccaagtggcggtggcggcggaggcggtg
ccggtgccggtgccggggccgcggatccccagggaggcgcggagcctgctgcacgagctg
gcggcggcgtgggcggacgtggcggactgccgcgcgctggaggtcgtgccgctcaagggt
gccatgaccaacgaggtctaccaggtgcgctggctcaccggccctgccgctgccggcgag
aaggaggagcctaggagggagagggaggtgaggaaggtgctcgtgcggatttacggcgac
ggcgtcgaccttttcttcgaccgcgaggacgaggtgcgcaccttcgagtgcatgtcccgc
catggccagggtccccgcctcctcggccgcttccccaacggccgcgtcgaggagttcatc
cacgcaaggacattgtcagctgccgaccttcgtgatccggaaatttcagctcttgtggcg
tctaaactgagagaattccacaaccttgacatgcctggtcccaaatctgtgctcatttgg
gacagactgaggaactggctcagaactgccaagaacttgtgcccatctgaagaagccaag
gaatttcggttggacagtctggagaacgagattactgcattggagaatgagtgttcaggt
gattaccaatggattggtttctgtcacaatgatcttcagtatggcaatatcatgattgat
gaagagaccaacgtgctgaccatcattgattttgagtatgcaagcttcaacccggttgca
tatgacattgctaaccatttctgtgagatggcagcagactatcattcatcaaagcctcat
atactggactacagcagatatccagatgttgatgagcagaagcgcttcgttaagacctac
ctgaacatttctggtgaggaaccggatgcagaagttgtggagaacctgctccaacgcatt
gataagtacatgctcgccagccatctagtatggggcctctggggaataatttcggaccac
gttaacgacattgactttgactacaaggagtatgcgaggcagagattcgagcagtactgg
cagaagaagtctgcaatcttaacatcttga

DBGET integrated database retrieval system