KEGG   Sorghum bicolor (sorghum): SORBI_03g033190Help
Entry
SORBI_03g033190   CDS       T01086                                 

Gene name
SORBIDRAFT_03g033190, Sb03g033190
Definition
hypothetical protein
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Plant-pathogen interaction
Class
Organismal Systems; Environmental adaptation; Plant-pathogen interaction [PATH:sbi04626]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 355 aa AA seqDB search
MRGKKPLKDLRLSVPAQETPVDKFLTASGTFKDGELRLNQSGLRLISEENGGEDESTKLK
VEDVQLSMDDLEMIQVIGKGSGGIVQLVRHKWVGTLYALKGIQMNIQESVRKQIVQELKI
NQATQCPHIVMCHQSFYHNGVIYLVLEYMDRGSLADIVKQVKTVLEPYLAVLCKQVLEGL
LYLHHERHVIHRDIKPSNLLVNRKGEVKITDFGVSAVLASSIGQRDTFVGTYNYMAPERI
SGSSYDYKSDIWSLGLVILECAIGRFPYIPSEGEGWLSFYELLEAIVDQPPPSAPADQFS
PEFCSFISSCIQKDPAQRMSASELLNHPFLKKFEDKDLDLRILVEDLEPPMNIPE
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagggggaaaaagccgctcaaggacctcaggctctccgtgccggcgcaggagaccccc
gtcgacaagttcctgacggcaagtggtacgttcaaggatggtgagctgcggctcaatcaa
agtggcttgcgacttatctccgaggaaaatgggggtgaagatgaatcaacaaagctgaag
gtggaagatgtgcagttatcaatggatgatcttgagatgattcaagtcattggcaaagga
agtggtggcattgtccagctagtgaggcacaaatgggtggggacattgtatgccttaaag
ggtatacaaatgaacattcaggagtcagttcgtaaacaaatagtacaggagctcaaaata
aaccaagcaacacagtgccctcatatagttatgtgccatcaatctttttaccacaatggt
gtaatatatcttgttcttgagtacatggaccgtggatcacttgcagacattgttaagcaa
gtgaagactgttctggagccataccttgcggtactttgtaagcaggtcttggagggttta
ttgtatcttcatcatgaaaggcacgtgattcacagggacataaaaccatctaacttgttg
gtcaaccgtaaaggtgaagttaagattactgacttcggcgtgagtgctgtgctagcaagc
tcaataggacagcgagatacatttgttggaacctacaactatatggcgcctgagcggatt
agtggtagttcttatgactacaaaagtgacatatggagtttgggcttagttatacttgag
tgtgccattggccggttcccttatataccttcagaaggtgaaggttggttaagcttttat
gaactactggaggctattgtcgatcagccaccaccttctgcacctgcagatcagttctct
ccagaattctgctcatttatctcctcttgcatacaaaaagatccggctcagcggatgtct
gcttcagaactcttgaaccacccttttttgaagaagtttgaggataaggatctagacctg
cggattctcgtcgaggacctggaacctccaatgaatatacccgaatag

DBGET integrated database retrieval system