KEGG   Sorghum bicolor (sorghum): SORBI_03g033190Help
Entry
SORBI_03g033190   CDS       T01086                                 

Gene name
SORBIDRAFT_03g033190, Sb03g033190
Definition
hypothetical protein
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    SORBI_03g033190 (SORBIDRAFT_03g033190)
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     SORBI_03g033190 (SORBIDRAFT_03g033190)
Protein kinases [BR:sbi01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   SORBI_03g033190 (SORBIDRAFT_03g033190)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 355 aa AA seqDB search
MRGKKPLKDLRLSVPAQETPVDKFLTASGTFKDGELRLNQSGLRLISEENGGEDESTKLK
VEDVQLSMDDLEMIQVIGKGSGGIVQLVRHKWVGTLYALKGIQMNIQESVRKQIVQELKI
NQATQCPHIVMCHQSFYHNGVIYLVLEYMDRGSLADIVKQVKTVLEPYLAVLCKQVLEGL
LYLHHERHVIHRDIKPSNLLVNRKGEVKITDFGVSAVLASSIGQRDTFVGTYNYMAPERI
SGSSYDYKSDIWSLGLVILECAIGRFPYIPSEGEGWLSFYELLEAIVDQPPPSAPADQFS
PEFCSFISSCIQKDPAQRMSASELLNHPFLKKFEDKDLDLRILVEDLEPPMNIPE
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagggggaaaaagccgctcaaggacctcaggctctccgtgccggcgcaggagaccccc
gtcgacaagttcctgacggcaagtggtacgttcaaggatggtgagctgcggctcaatcaa
agtggcttgcgacttatctccgaggaaaatgggggtgaagatgaatcaacaaagctgaag
gtggaagatgtgcagttatcaatggatgatcttgagatgattcaagtcattggcaaagga
agtggtggcattgtccagctagtgaggcacaaatgggtggggacattgtatgccttaaag
ggtatacaaatgaacattcaggagtcagttcgtaaacaaatagtacaggagctcaaaata
aaccaagcaacacagtgccctcatatagttatgtgccatcaatctttttaccacaatggt
gtaatatatcttgttcttgagtacatggaccgtggatcacttgcagacattgttaagcaa
gtgaagactgttctggagccataccttgcggtactttgtaagcaggtcttggagggttta
ttgtatcttcatcatgaaaggcacgtgattcacagggacataaaaccatctaacttgttg
gtcaaccgtaaaggtgaagttaagattactgacttcggcgtgagtgctgtgctagcaagc
tcaataggacagcgagatacatttgttggaacctacaactatatggcgcctgagcggatt
agtggtagttcttatgactacaaaagtgacatatggagtttgggcttagttatacttgag
tgtgccattggccggttcccttatataccttcagaaggtgaaggttggttaagcttttat
gaactactggaggctattgtcgatcagccaccaccttctgcacctgcagatcagttctct
ccagaattctgctcatttatctcctcttgcatacaaaaagatccggctcagcggatgtct
gcttcagaactcttgaaccacccttttttgaagaagtttgaggataaggatctagacctg
cggattctcgtcgaggacctggaacctccaatgaatatacccgaatag

DBGET integrated database retrieval system