KEGG   Sorghum bicolor (sorghum): SORBI_03g034110Help
Entry
SORBI_03g034110   CDS       T01086                                 

Gene name
SORBIDRAFT_03g034110, Sb03g034110
Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Exosome [BR:sbi04147]
 Exosomal proteins
  Proteins found in most exosomes
   SORBI_03g034110 (SORBIDRAFT_03g034110)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 131 aa AA seqDB search
MSWQTYVDEHLMCEIEGHHLTSAAIIGHDGTVWAQSTAFPQFKPEEMTNIMKDFDEPGFL
APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE
RLGDYLVEQGL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcagacgtacgtcgacgagcacctcatgtgcgagatcgagggccaccacctc
acctccgccgccatcatcggccacgacggcaccgtctgggcccagagcaccgcgttcccg
cagttcaagcctgaggagatgaccaacatcatgaaggacttcgacgagcccgggttcctg
gccccgaccggcctcttcctcggccccaccaagtacatggtcatccaaggcgagcccggc
gccgtcatccgcgggaagaagggatctggaggcataaccgtgaagaagaccggacaggcg
ctggtgatcggcatctacgacgagcccatgacccccgggcagtgcaacatggtggtcgag
aggctcggcgactacctcgtagagcaaggcctgtaa

DBGET integrated database retrieval system