KEGG   Sorghum bicolor (sorghum): SORBI_03g036460Help
Entry
SORBI_03g036460   CDS       T01086                                 

Gene name
SORBIDRAFT_03g036460, Sb03g036460
Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SORBI_03g036460 (SORBIDRAFT_03g036460)
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     SORBI_03g036460 (SORBIDRAFT_03g036460)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 483 aa AA seqDB search
MEDDRATANVRVDGAPAEATLSGGELRWRRGGAGGAGPERALSLESDVLGVQVTGKEVVV
RAFVAAGAARALSCAGAGGKRCRRDFVLQMADGEGAAVAWGEGLTRYLDSFGRPKRLFVF
VNPFGGKKCARKIYDTEIKPLFEAAETEYQGHAREVVYSLDLAEYDGVVCVSGDGVLVEV
VNGILQRTDWEEAIKVPIGVVPAGSGNGMAKSLLHAASEKYSVSNAVFAIIKGYFSNFFP
TYHAQNYMTHGDFRWREGNMNFLVFREMMPEVLTKPLALFQALVRIMNLRKYCGSIQFVP
APGYEAYGEPIKQVKNSIVESVEQNGKSHRSSYPGPSVEFQASDWRFIDGPFIAVWVNNV
PWAAEDIMAAPEAKFSDGYMDAAILRDCPKADLLALLMKMSDGSYVKSPYVAYLKVRTFQ
LSPGQLVENPKRGGIIDVDGEVIARGKGTYDKNQHQDVMAYGQPIQLTVHQALATIYCPD
KIH
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgaccgcgccacggccaatgtccgcgtggacggcgcgccggcggaagccacg
ctcagcggcggggagctgcggtggcgccgcggcggtgctggcggggccgggccggagcgg
gcgctgtcgctggagagcgacgtgctcggggtccaggtgacggggaaggaggtcgtcgtc
agggccttcgtggcggcgggcgcggcgagggcgctgtcgtgcgcgggcgcgggagggaag
cggtgcagaagggacttcgtgctccagatggcggacggcgagggcgccgccgtggcctgg
ggagaggggctcacacgctacctcgactccttcggccgccccaagagattgttcgtcttc
gtcaaccccttcggcggcaagaaatgcgccaggaagatctacgacacggaaatcaagcct
ctgtttgaagctgcggagaccgagtaccaggggcatgcccgggaggtggtgtattccctc
gacctcgcggagtacgacggcgtcgtctgcgttagcggtgatggcgtcctcgtggaggta
gtgaacggaattcttcaacggacagattgggaggaggcaataaaagtgcctatcggtgta
gttccagcaggttcaggaaatggcatggctaaatcacttctgcatgctgccagtgagaaa
tactcggtttcaaatgctgtatttgccataatcaaaggttacttctctaatttctttccc
acctatcatgctcaaaactacatgacacatggagatttccggtggagagaaggaaacatg
aatttcttggtgttcagggaaatgatgcctgaagtcttaacaaagcccttagccttgttt
caggctctggtgcgcataatgaacttgcgaaaatactgtggaagtattcagttcgtgcct
gccccaggctacgaggcatatggagaacccatcaagcaagtcaagaattccattgtagag
tctgtggagcaaaatggaaaatctcatcggtcttcttatccaggtccttcagttgagttt
caagcttcagattggagatttattgatggcccatttattgcagtttgggtaaacaacgtg
ccatgggctgctgaggatatcatggcggctccagaggcaaagttctcagatggctatatg
gatgcagccatactcagagattgtccaaaggctgatcttttagctctattgatgaagatg
agcgacggcagttatgtcaaatcaccatatgttgcttacctcaaggtgagaacttttcaa
ttatcaccaggccagcttgttgagaaccccaaaaggggtggcattatagatgtggacgga
gaggtaattgctagaggaaaaggaacttacgacaaaaaccaacatcaagatgtgatggct
tatggccaacctattcagctgacagtgcaccaagcattggctaccatatattgccctgac
aaaattcactga

DBGET integrated database retrieval system