KEGG   Sorghum bicolor (sorghum): SORBI_03g037310Help
Entry
SORBI_03g037310   CDS       T01086                                 

Gene name
SORBIDRAFT_03g037310, Sb03g037310
Definition
hypothetical protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sbi00900]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 366 aa AA seqDB search
MWCVSRASSLTRNPHLPTLPRRRRALLAAKVSYDPQARFNQIADQIDKDAGMTRLNLFSP
CKINVFLRITGKRPDGFHDLASLFHVISLGDTIKFSLSPSKSRDRLSTNVPGVPVDESNL
IIKALNLYRQKTGTNNFFWIHLDKKVPTGAGLGGGSSNAATALWAANQFAGCIASEKDLQ
EWSGEIGSDIPFFFSQGAAYCTGRGEIVQDIPNPLPENLPMVLIKPPEACSTAEVYKRFK
LEQTSQADPLTLLKEITQNGISQDVCVNDLEPPAFEVLPSLKRLKKRIIAASRDDYSAVF
MSGSGSTIVGIGSPDPPAFVYDDEDYKDVFWSEACLLTRDENEWYREPISSNATSSKDGL
EASVAD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtggtgtgtgtcacgcgcctcgtcactcacccgcaaccctcatctccccactctcccc
cgtcgacggcgggcgctcctggcagcaaaggtctcttatgacccacaagcaaggtttaac
cagatagcggaccaaattgacaaggatgctggaatgacacggcttaacctattttcacct
tgcaaaattaatgtgttcttgaggataacgggtaagagaccagatgggttccacgacctg
gcttctctatttcatgtgataagtttgggtgatacgatcaaattttcattgtcaccaagt
aaaagcagagatcgcctgtcaaccaatgttccaggtgtcccagttgatgaaagcaatttg
atcatcaaggcactcaacctttaccgacagaaaacagggactaataactttttttggata
catcttgataagaaggtcccaactggtgctggtctcggtggtggaagcagcaatgctgca
actgcactttgggctgctaaccagtttgctggctgtatagcttcagagaaggatcttcaa
gagtggtctggtgagattggatcagatatcccctttttcttttcacaaggagcagcatat
tgtactggtagaggagagattgtccaagatatcccaaatcccttgccggaaaatttacca
atggttcttataaagccgcctgaagcatgctcaactgctgaagtttacaagcgattcaaa
ttggaacaaacaagtcaagctgatcccttgaccttgctcaaggaaataactcaaaatggg
atatcacaagatgtttgtgttaatgacctagagcctccagcttttgaggtgttaccttca
cttaagaggttgaagaaacgaattattgcagctagccgggatgattatagtgctgttttt
atgtcaggaagtggaagcacaattgttgggattggttccccggatcctcctgcattcgtg
tatgacgatgaagactacaaggatgttttttggtcagaggcttgcttgctcactcgcgat
gagaacgagtggtacagggaaccaatctcgtccaatgccacgtctagcaaagatggtttg
gaagcctcggtcgctgactga

DBGET integrated database retrieval system