KEGG   Sorghum bicolor (sorghum): SORBI_03g037660Help
Entry
SORBI_03g037660   CDS       T01086                                 

Gene name
SORBIDRAFT_03g037660, Sb03g037660
Definition
hypothetical protein
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:sbi00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 742 aa AA seqDB search
MNRPSNFMPTPEQDVLDVKPLRTLAPMFPAPLGVNTFNQSTTPPLVFVTPAGQFQGGFDA
WSNSAAKSFFAFGGEDASGGKAHKFGDQNTGGGKAPTFGDQDAFGSQNIATGVQDAAGGQ
TATDWTSDVSANPNGPIDATPISAYRSTQPNVISLDDDDDDDDDDDEPYAAKKTSASGRK
IKRPSHLSGYSVSDGLVSDSSNSMKVKRPKSSHKKAVADSEHALLPPSDDPRETVEAVLM
TFEALRRRHLQLDEAQETNKRADLKASAIMMSKNIRANSGKRIGAVPGVEIGDIFYFRME
LCIIGLHAPSMAGIDYMTAKFGDEDDSVAICIVAAGVYDNNDDDTDVLVYSGSGGNSKNS
EERHDQKLERGNLALERSLSRKNVIRVVRGYKDPGCLSGKVYIYDGLYRIHESWKEKTKS
GIFCFKYKLLREPGQPDGVAIWKMSQKWVENPITRGSVLHSDLSSGAENLPVFLVNDIDS
DKGPHHFTYTTRVKHLKPLSSVKPLEACRCLSVCLPGDANCCCAQRNGGSLPYSSSGLLV
CRKNMVYECGESCRCSFNCRNRVTQKGVRIHFEVFKTGNRGWGLRSWDAIRAGSFICEYV
GEVIDDAKIDLSDIEDDYIFQTLCPGESTLKWNFGPELIGEQSTDISADTFETLPIKISA
KRMGNISRFMNHSCAPNVFWQPVQFDNEDDHSPHIMFFALKHIPPMTELTYDYGDIGADS
SARSPRAKNCLCGSSNCRGFFI
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtccatcgaatttcatgcctactcctgaacaggatgttctggatgtcaagccc
ttgaggacattggctccaatgttccctgcacccctcggtgtcaatacatttaaccagtca
accacgccaccattggtattcgtcactcctgctggacaatttcaagggggttttgatgct
tggagcaattctgctgctaaatcatttttcgctttcggcggtgaggatgctagtggaggg
aaggctcacaaatttggtgatcagaatactggtggtggcaaggctcccacttttggtgat
caggatgcttttggtagccagaatatcgccactggtgtgcaggatgctgctggaggccag
actgcaacagattggacgtcagatgtgagtgccaatcctaatggcccaattgacgccacc
cccatttcagcttacaggtcaacacagcctaatgttatatcactggatgatgatgatgat
gacgacgacgacgacgatgagccttatgctgctaaaaagacatcagcatctggacgcaag
atcaagaggccatcccatctcagcggatacagtgtgagcgatggtttggtaagtgacagc
tccaacagcatgaaggttaagcgccccaaatcctctcacaagaaagctgttgctgacagt
gagcatgccttgcttcctccatctgatgatcctagggaaactgtggaggcagttctcatg
accttcgaggcattgcggcgtaggcatctccaattggatgaggcacaagagactaacaaa
cgtgcagacctgaaggctagtgccatcatgatgtccaagaatatcagggccaactctggg
aagaggataggggctgttcctggagttgaaataggggacattttctacttcaggatggag
ctatgtattatcggacttcatgctcctagcatggccggaattgactatatgactgccaag
tttggtgatgaggatgattctgttgcaatatgtattgttgctgcaggtgtttatgacaac
aatgatgatgatacagatgtactggtttacagcggttcagggggtaatagcaagaacagt
gaggagaggcatgaccagaagcttgagaggggtaacctggctcttgaaaggagcttgtcc
agaaagaatgtaatccgtgtggttcggggctataaggatccaggttgcttgtctgggaag
gtttatatttatgatggcctctacaggattcacgagtcatggaaggagaaaacgaagagt
ggaatattttgtttcaagtacaagctgctgcgggagccaggacaacctgatggggttgca
atctggaagatgtcccagaaatgggtagagaatccaataactagaggcagtgttttacat
tctgatctatcatctggtgcagaaaatctcccggtgtttcttgttaatgacattgacagt
gataaagggccacaccatttcacctataccactcgggtcaaacacttgaaaccactcagt
tctgtgaaacctttagaggcttgcagatgccttagtgtttgtctgcctggtgatgccaac
tgctgttgtgcacagcgtaatggaggcagcttaccttacagctcatcaggattgcttgta
tgccgcaagaatatggtttatgaatgcggtgaatcctgtcggtgttctttcaattgccgt
aacagagtgactcagaaaggagttaggatccactttgaggtctttaaaactggaaatcga
ggctggggtcttcgttcatgggacgctatacgggctggttcatttatatgcgagtatgtt
ggtgaggttattgatgatgctaaaattgatttgagtgatattgaagatgattatatattt
cagacgttgtgccctggtgagagtacattaaaatggaattttggacctgagttgataggg
gagcaaagcacagatatttcagctgatacttttgaaactctacccattaagataagtgct
aaaagaatgggaaacatctcacgtttcatgaaccatagttgtgctcctaatgtcttttgg
cagccagttcagtttgacaatgaagatgatcatagcccacatatcatgttctttgctttg
aagcatattcctcccatgacagagttgacttatgactatggtgacattggagctgattct
agtgcacggtctcctagagcaaagaactgcctttgtggatcctcaaattgtcggggattc
tttatctga

DBGET integrated database retrieval system