KEGG   Sorghum bicolor (sorghum): SORBI_03g037860Help
Entry
SORBI_03g037860   CDS       T01086                                 

Gene name
SORBIDRAFT_03g037860, Sb03g037860
Definition
hypothetical protein
Orthology
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SORBI_03g037860 (SORBIDRAFT_03g037860)
   01230 Biosynthesis of amino acids
    SORBI_03g037860 (SORBIDRAFT_03g037860)
  Energy metabolism
   00920 Sulfur metabolism
    SORBI_03g037860 (SORBIDRAFT_03g037860)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SORBI_03g037860 (SORBIDRAFT_03g037860)
Enzymes [BR:sbi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     SORBI_03g037860 (SORBIDRAFT_03g037860)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 384 aa AA seqDB search
MAMAPPPACSLFLRVAAAAPSSVTSSSVLTQRGSGLLPSPRPASPRRHLTAAWSSKAAAS
ASVEIQDDYADEMDAVNIAQDVTQLIGKTPMVYLNSVADGCVANIAAKLEYMGPCRSVKD
RIGLSMINDAEEKGLISPDKTILVEPTTGNTGVAIAAVAAARGYKLIATMPSSIDVERRV
LLRAFGAEVVLTDPTKGLKGAFDKAEEIVLRTPNAYMFQQFNNEANSEIHFQTTGPEIWE
DTLGSVDILVASIGTGGTITGTGRYLKRMNKDIKVIGVEPAETSVISGDNPGYIPSILDV
QLIDEVVKVSTAEAVDSARELALKEGLLVGISSGAAAIAAINVAKRPENAGKLIAVIFPS
FGERYISSILFRPIYDSVRRMRKR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggctccgccgcccgcctgctcgctcttcctccgggtcgccgccgctgcgccc
agttccgtcacctccagctccgttttgacccagcgcggcagcggtctcctcccttccccg
cgtcccgcttccccccgccgccaccttaccgcggcatggtcatcgaaggccgcggcctcc
gcttcagtcgaaatacaggatgactacgcggatgagatggacgcggtgaacattgcgcag
gacgttacccagttaattggaaaaacaccaatggtgtatctcaatagtgttgctgacggt
tgtgtcgctaatattgctgcaaagctcgagtacatgggaccttgccgaagtgtcaaagat
aggattggattaagcatgattaatgatgctgaagagaagggtttaatttctccagataag
accattttggtagaaccaacaactggaaatactggtgtagccattgctgctgtggctgca
gcaagaggatacaagttgatagcaactatgccttcatcaatagatgtcgagagacgtgtt
cttctgcgtgcattcggagcagaggttgtgttaactgatcctaccaaaggactaaaagga
gcttttgataaagctgaggaaatagttttgagaacaccaaatgcgtatatgtttcagcag
ttcaataatgaggccaatagtgagatccactttcaaaccacaggcccagaaatatgggaa
gacacgttgggttctgttgatatacttgttgcaagcataggaacaggcggtaccattact
ggcactgggcgttacttgaaaaggatgaacaaagatattaaggttattggggtagaacct
gctgaaactagtgtgatttctggtgataaccctggttacattccaagtatattagatgtt
cagttgattgatgaggttgtgaaggttagcacagcagaagctgttgattctgcaagggaa
cttgcactaaaagagggcttgctggttggtatctcctctggtgctgcagcaattgctgct
attaatgttgccaaaagacctgaaaatgccggaaagctgattgcggtcattttccctagc
tttggagagaggtacatctccagcatcctattccgtccgatatatgactctgttcgaaga
atgaggaagagatag

  All links  
No link information was found.   
DBGET integrated database retrieval system