KEGG   Sorghum bicolor (sorghum): SORBI_03g037860Help
Entry
SORBI_03g037860   CDS       T01086                                 

Gene name
SORBIDRAFT_03g037860, Sb03g037860
Definition
(RefSeq) hypothetical protein
  KO
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SORBI_03g037860 (SORBIDRAFT_03g037860)
   01230 Biosynthesis of amino acids
    SORBI_03g037860 (SORBIDRAFT_03g037860)
  Energy metabolism
   00920 Sulfur metabolism
    SORBI_03g037860 (SORBIDRAFT_03g037860)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SORBI_03g037860 (SORBIDRAFT_03g037860)
Enzymes [BR:sbi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     SORBI_03g037860 (SORBIDRAFT_03g037860)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 384 aa AA seqDB search
MAMAPPPACSLFLRVAAAAPSSVTSSSVLTQRGSGLLPSPRPASPRRHLTAAWSSKAAAS
ASVEIQDDYADEMDAVNIAQDVTQLIGKTPMVYLNSVADGCVANIAAKLEYMGPCRSVKD
RIGLSMINDAEEKGLISPDKTILVEPTTGNTGVAIAAVAAARGYKLIATMPSSIDVERRV
LLRAFGAEVVLTDPTKGLKGAFDKAEEIVLRTPNAYMFQQFNNEANSEIHFQTTGPEIWE
DTLGSVDILVASIGTGGTITGTGRYLKRMNKDIKVIGVEPAETSVISGDNPGYIPSILDV
QLIDEVVKVSTAEAVDSARELALKEGLLVGISSGAAAIAAINVAKRPENAGKLIAVIFPS
FGERYISSILFRPIYDSVRRMRKR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggctccgccgcccgcctgctcgctcttcctccgggtcgccgccgctgcgccc
agttccgtcacctccagctccgttttgacccagcgcggcagcggtctcctcccttccccg
cgtcccgcttccccccgccgccaccttaccgcggcatggtcatcgaaggccgcggcctcc
gcttcagtcgaaatacaggatgactacgcggatgagatggacgcggtgaacattgcgcag
gacgttacccagttaattggaaaaacaccaatggtgtatctcaatagtgttgctgacggt
tgtgtcgctaatattgctgcaaagctcgagtacatgggaccttgccgaagtgtcaaagat
aggattggattaagcatgattaatgatgctgaagagaagggtttaatttctccagataag
accattttggtagaaccaacaactggaaatactggtgtagccattgctgctgtggctgca
gcaagaggatacaagttgatagcaactatgccttcatcaatagatgtcgagagacgtgtt
cttctgcgtgcattcggagcagaggttgtgttaactgatcctaccaaaggactaaaagga
gcttttgataaagctgaggaaatagttttgagaacaccaaatgcgtatatgtttcagcag
ttcaataatgaggccaatagtgagatccactttcaaaccacaggcccagaaatatgggaa
gacacgttgggttctgttgatatacttgttgcaagcataggaacaggcggtaccattact
ggcactgggcgttacttgaaaaggatgaacaaagatattaaggttattggggtagaacct
gctgaaactagtgtgatttctggtgataaccctggttacattccaagtatattagatgtt
cagttgattgatgaggttgtgaaggttagcacagcagaagctgttgattctgcaagggaa
cttgcactaaaagagggcttgctggttggtatctcctctggtgctgcagcaattgctgct
attaatgttgccaaaagacctgaaaatgccggaaagctgattgcggtcattttccctagc
tttggagagaggtacatctccagcatcctattccgtccgatatatgactctgttcgaaga
atgaggaagagatag

DBGET integrated database retrieval system