KEGG   Sorghum bicolor (sorghum): SORBI_03g037860Help
Entry
SORBI_03g037860   CDS       T01086                                 

Gene name
SORBIDRAFT_03g037860, Sb03g037860
Definition
hypothetical protein
Orthology
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Class
Metabolism; Overview; Carbon metabolism [PATH:sbi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sbi01230]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sbi00920]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:sbi00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 384 aa AA seqDB search
MAMAPPPACSLFLRVAAAAPSSVTSSSVLTQRGSGLLPSPRPASPRRHLTAAWSSKAAAS
ASVEIQDDYADEMDAVNIAQDVTQLIGKTPMVYLNSVADGCVANIAAKLEYMGPCRSVKD
RIGLSMINDAEEKGLISPDKTILVEPTTGNTGVAIAAVAAARGYKLIATMPSSIDVERRV
LLRAFGAEVVLTDPTKGLKGAFDKAEEIVLRTPNAYMFQQFNNEANSEIHFQTTGPEIWE
DTLGSVDILVASIGTGGTITGTGRYLKRMNKDIKVIGVEPAETSVISGDNPGYIPSILDV
QLIDEVVKVSTAEAVDSARELALKEGLLVGISSGAAAIAAINVAKRPENAGKLIAVIFPS
FGERYISSILFRPIYDSVRRMRKR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggctccgccgcccgcctgctcgctcttcctccgggtcgccgccgctgcgccc
agttccgtcacctccagctccgttttgacccagcgcggcagcggtctcctcccttccccg
cgtcccgcttccccccgccgccaccttaccgcggcatggtcatcgaaggccgcggcctcc
gcttcagtcgaaatacaggatgactacgcggatgagatggacgcggtgaacattgcgcag
gacgttacccagttaattggaaaaacaccaatggtgtatctcaatagtgttgctgacggt
tgtgtcgctaatattgctgcaaagctcgagtacatgggaccttgccgaagtgtcaaagat
aggattggattaagcatgattaatgatgctgaagagaagggtttaatttctccagataag
accattttggtagaaccaacaactggaaatactggtgtagccattgctgctgtggctgca
gcaagaggatacaagttgatagcaactatgccttcatcaatagatgtcgagagacgtgtt
cttctgcgtgcattcggagcagaggttgtgttaactgatcctaccaaaggactaaaagga
gcttttgataaagctgaggaaatagttttgagaacaccaaatgcgtatatgtttcagcag
ttcaataatgaggccaatagtgagatccactttcaaaccacaggcccagaaatatgggaa
gacacgttgggttctgttgatatacttgttgcaagcataggaacaggcggtaccattact
ggcactgggcgttacttgaaaaggatgaacaaagatattaaggttattggggtagaacct
gctgaaactagtgtgatttctggtgataaccctggttacattccaagtatattagatgtt
cagttgattgatgaggttgtgaaggttagcacagcagaagctgttgattctgcaagggaa
cttgcactaaaagagggcttgctggttggtatctcctctggtgctgcagcaattgctgct
attaatgttgccaaaagacctgaaaatgccggaaagctgattgcggtcattttccctagc
tttggagagaggtacatctccagcatcctattccgtccgatatatgactctgttcgaaga
atgaggaagagatag

DBGET integrated database retrieval system