KEGG   Sorghum bicolor (sorghum): SORBI_03g037870Help
Entry
SORBI_03g037870   CDS       T01086                                 

Gene name
SORBIDRAFT_03g037870, Sb03g037870
Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SORBI_03g037870 (SORBIDRAFT_03g037870)
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     SORBI_03g037870 (SORBIDRAFT_03g037870)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 279 aa AA seqDB search
MDFLQGQSVETTVAVAVAVVAIAAGGAFLLLRSRKPKGCLDPENFRKFKLVEKKQISHNV
ARFKFALPTPTSVLGLPIGQHISCRGQDATGEEVIKPYTPTTLDSDLGYFELVIKMYPQG
RMSHHFREMKVGDYLSVKGPKGRFKYQVGQVRAFGMLAGGSGITPMFQVARAILENPNDN
TKVHLIYANVTYEDILLKDELDSMAKTYPGRFKIYYVLNQPPENWNGGVGFVSKEMIQSH
CPAPAEDIQILRCGPPPMNKAMAAHLDELNYTKEMQFQF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggattttctgcaggggcaaagcgtcgagaccacagtggccgtcgccgtcgccgtcgtc
gccatcgccgcgggcggcgccttcctcctcctccgatccaggaagcccaagggctgtttg
gatcctgagaacttcaggaagttcaaacttgttgaaaagaagcaaataagtcataatgtt
gccaggttcaaattcgctcttccaactccgacttctgtattgggccttccaatcggtcaa
catatcagttgcagaggacaagatgctactggtgaagaagtaatcaagccatatacccct
actacattggattctgatcttggatatttcgagcttgtcataaagatgtatcctcaaggg
agaatgtcccatcatttccgcgagatgaaagttggtgattatttgtctgtgaagggacct
aagggccgtttcaagtaccaagttggccaagtgagagcatttggaatgctggctggtgga
tcaggcattactccaatgttccaagttgccagagcaatccttgagaaccctaatgacaac
accaaggttcacttaatttatgctaatgtcacatatgaagacattcttctgaaggatgag
ctggacagcatggccaaaacctatcctggtcgctttaagatctactacgtgttgaatcag
cctcctgagaactggaatggtggtgttgggtttgtgtcgaaggaaatgatccaatctcat
tgcccagcacctgctgaggacattcagatcctgagatgtggtcctcctccgatgaacaag
gccatggctgcacaccttgacgagctcaactacacaaaggagatgcagttccagttctaa

DBGET integrated database retrieval system