KEGG   Sorghum bicolor (sorghum): SORBI_03g040050Help
Entry
SORBI_03g040050   CDS       T01086                                 

Gene name
SORBIDRAFT_03g040050, Sb03g040050
Definition
hypothetical protein
Orthology
K09591  
steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Brassinosteroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    SORBI_03g040050 (SORBIDRAFT_03g040050)
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     SORBI_03g040050 (SORBIDRAFT_03g040050)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 202 aa AA seqDB search
MESPTLWLPPLVLLRSPPPRLSGPLAALPAALYAFHYVHRTLVHPLRLACLRRATAPVPL
LIAACAFGFSLLNAYVQARSFALHAGRPASPARCLAGLALFAWGMRTNIAADKELLRLKE
AGGGYKIPRGGWFDLVTSPNYFGETVEWLGFAVVAWTPAAWAFFLYTCANLGPRARDHRR
WYVQKFGGEYPASRKAFIPYIY
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggagagccccaccctctggctcccgccgctcgtcctcctccgctcgccgccgccgcgg
ctctccggcccgctcgccgccctccccgccgcgctctacgcgttccactacgtccaccgc
acgctggtccacccgctccgcctcgcctgcctgcgccgcgccacggcccccgtcccgctc
ctcatcgccgcctgcgccttcggattcagtctcctcaacgcctacgtgcaggcccgctcc
ttcgcgctccacgccggccgcccggcgtcccccgcccgctgcctcgccgggctggccctc
ttcgcatgggggatgcggaccaacatcgcggcggacaaggagctgctgcggctcaaggag
gccggaggcgggtacaagatcccgaggggcgggtggttcgacctggtcaccagtcccaat
tacttcggcgagacggtggagtggctgggcttcgccgtggtggcgtggacgcccgcggcg
tgggcgttcttcctctacacctgcgccaatctcgggccgagggccagggaccatcgccgc
tggtacgtgcagaagttcggcggcgagtacccggcgtcgcgcaaggcgttcatcccctac
atctactag

DBGET integrated database retrieval system