KEGG   Sorghum bicolor (sorghum): SORBI_03g042000Help
Entry
SORBI_03g042000   CDS       T01086                                 

Gene name
SORBIDRAFT_03g042000, Sb03g042000
Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SORBI_03g042000 (SORBIDRAFT_03g042000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 112 aa AA seqDB search
MASFSEAPPGNPTAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSTA
NKSMAVIWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKNATA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgttctctgaggcgcctccggggaacccaactgccggcgagaagatcttcaag
accaagtgcgcgcagtgccacaccgtcgacaagggcgccggccacaagcaaggtcctaat
ttgaatggtctatttgggaggcagtctggtacaacacctggttactcttactccacagct
aacaagagcatggctgtaatttgggaggagaacactttgtatgactacctgcttaatcct
aagaagtacattcctggaaccaagatggtattccctggactgaaaaagccacaggaacgt
gctgatctcattgcatacctgaagaatgccactgcctga

DBGET integrated database retrieval system