KEGG   Sorghum bicolor (sorghum): SORBI_03g042610Help
Entry
SORBI_03g042610   CDS       T01086                                 

Gene name
SORBIDRAFT_03g042610, Sb03g042610
Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:sbi04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 655 aa AA seqDB search
METLMVDRVHSSLRLFMHRNAVFLCERLCAQFPSETNVQLLATCYLHNNQPYAAYHILKG
KKMPESRYLFATSCFRMNLLREAEETLCPVNEPNMEVPSGATGHYLLGVIYRCTGRISAA
AEQFTQALTLDPLLWAAYEELCILGIAEDTDECFSESTALRLQQEHTSTSTLVKSNFANE
NRVLSSRVSASLGDISPKQIKQLHANNIAEVSGYPHVRPTALHVQNSSTSNVAQFDTPSP
TAAQTSSIMPPPLFRNVHAYQNTVSGDAPTKQKTNGVNQPLRRKNIDEARLKKVSGRLFN
SDSIPRRSERLKDTATNSNSNTSQFGGNGAGHSSGSRYEVIDEMWTDNISGISSSVSATD
GRSFEQDKAERILLQDSKLALGIRELLGLFRTLGEGFRLSCLFKCQEALEVYRKLPESQF
NTGWVLCQVGKAYFELVDYLEADRYFELAHRLSPLQNSWMCLGHNHNRLVWKLGPHVSSF
SYVSVWNVQQVDERHYNAWYGLGVVYLRQEKFEFAEHHFRRAFQINPRSSVLMCYLGMAL
HSLKRDEEALEMMEKAIAADKKNPLPKYQKALILLGLMKYEEALDELERLKEIAPHESSM
FALMGKIYKQLNILDKAVFCFGIALDLKPPAADLAIIKSAMEKVHLPDELMEDDL
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccctaatggtggaccgcgtccacagcagcctccgcctcttcatgcaccgcaac
gcagtattcctctgcgagcgcctctgcgcgcagttcccctccgagaccaatgtgcaattg
ttagcgacctgctacctccacaacaatcagccatatgctgcataccacattttgaaaggg
aagaagatgccggagtcccggtacttgtttgctacatcatgttttcgaatgaacctcttg
cgtgaagcagaagaaactctatgtccagtcaatgaaccaaacatggaggttccaagtgga
gcaacaggacactacctccttggagtgatttacaggtgcacaggcagaatttcagctgca
gctgaacaatttacacaagcgttgactctagatcctcttttatgggcggcatatgaggaa
ttgtgtatattaggtattgctgaagataccgatgagtgttttagtgaatcgactgctcta
cgtctccagcaggaacacacatccacatccactctggtgaagtcaaacttcgccaatgaa
aatcgagttctatcttccagggtctcggcaagtcttggggatattagtcctaagcaaatc
aaacagcttcatgctaacaacatagcagaagtatctggctatcctcatgtaagaccaact
gcattgcatgtgcagaatagttcaacctctaatgtagcacagtttgacactccatcacca
actgcagcacagacttctagtatcatgccaccaccactctttaggaatgtccatgcttat
cagaatacagtaagtggcgatgctcccacgaagcagaaaactaatggagtaaaccagcca
cttagaaggaaaaacattgatgaagcaaggctaaagaaggtttccggaaggttgtttaat
agtgattcaatacctcgaagaagtgaaagacttaaagatacagcaacaaattcaaattca
aatacctctcaatttggagggaatggagcaggtcattcgtcaggaagtagatatgaagtc
attgatgaaatgtggacagacaatatatcaggaatttcatcttctgtaagtgcaactgat
ggaagatcctttgagcaagataaagctgaacgaattctgttgcaagactccaaattggca
cttggtattagggagctattgggacttttccgaacactcggggaaggttttaggctttct
tgcttgtttaagtgccaggaagcattggaagtctacagaaaactccctgagtcacagttt
aacactggatgggttctatgccaggtcggtaaggcatatttcgaattagttgattatttg
gaagctgatcgttactttgaattggcacaccgactatcgcctttgcaaaacagctggatg
tgtctaggccacaatcataaccgtttagtctggaagctgggtcctcatgtttcatcattt
tcttatgtatctgtttggaatgtgcaacaggtagatgaaaggcactacaatgcctggtat
ggccttggggtggtatatcttcgccaggaaaagtttgagtttgctgagcatcatttcaga
agggcatttcagataaatcctcgctcttctgttctcatgtgctaccttgggatggcattg
cactctcttaagagggatgaggaggcattggaaatgatggagaaagctatagcagcggat
aagaagaatccactgcccaagtatcagaaggccttaatccttctaggtctaatgaagtat
gaagaagctctggatgagttggagcggctaaaggagattgcgcctcatgagagtagtatg
tttgcactgatgggaaagatttacaagcaactcaatattcttgacaaagctgttttctgc
tttggcattgccctggatttaaaacctcctgctgctgatcttgctataattaagtccgca
atggagaaagtacatctccctgatgaactgatggaggatgacctgtaa

DBGET integrated database retrieval system