KEGG   Sorghum bicolor (sorghum): SORBI_03g047210Help
Entry
SORBI_03g047210   CDS       T01086                                 

Gene name
SORBIDRAFT_03g047210, Sb03g047210
Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SORBI_03g047210 (SORBIDRAFT_03g047210)
Translation factors [BR:sbi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    SORBI_03g047210 (SORBIDRAFT_03g047210)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 220 aa AA seqDB search
MADEIDTRPASAGSRGRPAHATEDDDREEGEIADDTPAPALPVTHPLEHSWTFWFDNPQG
KNKQAAWGSSIRPIHTFSTVEDFWGLYNNIHHPSKLVIGADFHCFKNKIEPKWEDPICAN
GGKWTISCGRGKSDTLWLHTLLAMIGEQFDYGDEICGAVVSVRGKQERIAIWTKNAANEA
AQISIGKQWKEFLDYKDSIGFIVHDDAKKADKGPRNRYTV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgagatcgacacgaggccggcctccgcgggctcccggggccgccccgcgcac
gctacggaggacgacgacagggaggagggagagatcgccgacgacacccccgcgcccgcc
ctccccgtcacgcacccgctcgagcactcatggaccttctggttcgacaacccgcagggc
aagaacaagcaggccgcctgggggagctccatccgacccatccacaccttctccaccgtc
gaggacttctggggcctttacaataatattcatcaccctagcaagttggtcattggagct
gacttccattgcttcaagaacaagattgaaccaaaatgggaagaccctatttgtgctaat
ggcggtaaatggaccatcagctgtggaagagggaaatctgacacactgtggctgcacact
ctgttggctatgattggcgaacaattcgactatggtgatgaaatttgtggagcagtcgtc
agcgtgcgtggcaagcaggaaagaatagctatctggacaaaaaatgctgctaatgaagct
gctcagataagcatcgggaagcagtggaaggaattcctggattacaaggactccattgga
ttcattgttcatgacgatgcaaagaaggcggacaagggaccaaggaaccgatacacggtt
tga

DBGET integrated database retrieval system