KEGG   Sorghum bicolor (sorghum): SORBI_04g000230Help
Entry
SORBI_04g000230   CDS       T01086                                 

Gene name
SORBIDRAFT_04g000230, Sb04g000230
Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SORBI_04g000230 (SORBIDRAFT_04g000230)
Enzymes [BR:sbi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SORBI_04g000230 (SORBIDRAFT_04g000230)
Exosome [BR:sbi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SORBI_04g000230 (SORBIDRAFT_04g000230)
  Exosomal proteins of colorectal cancer cells
   SORBI_04g000230 (SORBIDRAFT_04g000230)
  Exosomal proteins of bladder cancer cells
   SORBI_04g000230 (SORBIDRAFT_04g000230)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 572 aa AA seqDB search
MGSTTMSLPSFPAVLMLLLLATAAAAAAGSNKAEEELDDLQYLIDNSHDIPANDPDGWPE
GGGGGDDDDDDDLLFQDQDEDLLGHQPQIDETHVVVLTAANFSSFLSATRHVMVEFYAPW
CGHCQELAPEYAAAAAHLAAHPHQADLALAKVDATEETDLAQRYDVQGFPTILFFIDGVP
KDYNGARTKDAIVDWINKKLGPAVQNVTSVDEAERILTGDDKAVLAFLDTLSGAHSDELA
AASRLEDSINFYQTLTPDVAKLFHIDAATKRPSIVLLKKEEEKLTFYDGEFKASAIADFV
SANKLPLVTTLTQETSPSIFGNPIKKQILLFAIASESSKFLPIFKEAAKPFKGKLLFVFV
ERDNEEVGEPVADYFGITGQETTVLAYTGNEDAKKFFLDGEVSLEAIKDFAEGFLEDKLT
PFYKSEPVPESNDGDVKMVVGKNLDLIVLDESKDVLLEIYAPWCGHCQSLEPTYNKLARH
LRGVDSLVIAKMDGTANEHPRAKSDGYPTILFYPAGKKSFEPITFEGERTVVDMYKFIKK
HASIPFKLKRQESSTQMEEGVKSSDTNLKDEL
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgggatcaaccacaatgtcccttccatcattccccgccgtcctcatgctcctcctcctc
gccaccgccgccgccgccgccgccggaagcaacaaggctgaggaggagctggacgacctc
cagtaccttattgacaactcccacgacatccccgccaacgaccccgatgggtggcctgag
ggcggcggcggcggcgacgacgacgacgacgacgacctgctattccaagatcaggacgag
gacctcctgggccaccagccgcagatcgacgagacccacgtcgtggtcctcaccgccgcc
aacttctcctccttcctctccgccacccgccatgtcatggttgagttctacgccccctgg
tgtggccactgccaggagctcgccccggaatacgccgccgccgccgcgcatctcgccgcc
caccctcaccaggccgacctcgccctcgccaaggtcgacgccaccgaggaaaccgacctc
gcccagaggtacgacgtccagggcttccccaccatcctcttcttcatcgacggcgtcccc
aaggactacaacggcgccaggaccaaggacgccatcgtcgactggatcaacaagaagctc
ggcccggccgtgcaaaatgtcaccagcgtcgacgaggcggagaggatactcaccggggat
gacaaagccgtccttgccttcctcgacactctatccggtgctcacagtgacgagcttgct
gctgcttcaaggctggaagatagcatcaacttttatcagactttgactcccgatgttgct
aagcttttccatattgacgcagcaacaaagcgtccatccatagtacttctgaagaaagag
gaggagaagttgaccttctatgatggggagtttaaagcatcagccattgctgattttgtg
tctgctaacaagcttcctttggttaccacactaactcaagaaacttccccttccattttt
ggcaatccaatcaagaagcagattttactatttgctattgcaagcgagtcctccaaattt
ctgcccatctttaaggaagcagcaaagccatttaagggaaagctattatttgtctttgtg
gagcgagacaatgaggaagttggtgaaccagttgctgactactttggtattactggacaa
gagaccacagttcttgcttacactggcaatgaagatgctaagaaatttttccttgatggt
gaggtgtcacttgaagctattaaggactttgctgaaggtttcttggaagacaagcttaca
ccattctacaagtctgaaccagtacctgaatctaatgatggggatgtcaaaatggttgtt
gggaagaatctggatctaatagttttggatgaatcaaaagatgtacttctggagatatat
gcaccatggtgtgggcactgtcaatcactggagcctacttacaacaaactagccaggcat
ctacgtggcgttgactcccttgtgatagctaaaatggatggtactgccaatgagcatcca
cgtgcaaagtctgatggatacccaactattctcttctatccagctgggaagaaaagcttt
gagcctatcacttttgagggggagcggacagtggtagatatgtacaagttcatcaagaaa
catgctagcatccctttcaaattgaagcgccaggagtcgagcactcagatggaggagggt
gtaaagagctctgatacgaacctgaaggacgaactgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system