KEGG   Sorghum bicolor (sorghum): SORBI_04g000260Help
Entry
SORBI_04g000260   CDS       T01086                                 

Gene name
SORBIDRAFT_04g000260, Sb04g000260
Definition
hypothetical protein
Orthology
K05277  
leucoanthocyanidin dioxygenase [EC:1.14.11.19]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    SORBI_04g000260 (SORBIDRAFT_04g000260)
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.19  leucocyanidin oxygenase
     SORBI_04g000260 (SORBIDRAFT_04g000260)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 399 aa AA seqDB search
MARVEALSGLSSIPLEYVRPADERAGLGDAFDLARTHANDHTAPRIPVVDISPFLDASSS
SSQQQRDACVEAVRAAAVDWGVMHIAGHGIPAELMDRLRAAGAAFFALPIQEKEAYANDP
AAGRLQGYGSRLATNASGQREWEDYLFHLLQPDGLADHALWPAHPPDYVPATRDFGRRTR
ELTTTLLAILSMGLLGPERGDALEKALITRSQAAAEAAAEQQQQQQQDLDLLLQFKINYY
PRCPQPELAVGVETHTDVSALSFILHNGVPGLQVLHGGRWVTARDEPGTIIVHVGDALEI
LSNGRYTSVLHRGLVNREAVRISWVVFAEPPPDAVVLRPLPELVTPDHPARFTPRTFKQH
LDSKLFKKKQQEQQKADKDGNNNGDHHHDEPPPPQTQTN
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgtggaggctcttagcggcctctcctccatcccgctcgagtacgtccgcccc
gccgacgagcgagcgggcctcggggacgccttcgacctggcgcgcacccatgccaacgac
cacaccgcgccgaggatccccgtcgtcgacatctcccccttcctggacgccagcagcagc
agcagccagcagcagcgggacgcgtgcgtggaggccgtgcgcgccgccgccgtggactgg
ggcgtgatgcacatcgccggccacggcatccccgccgagctcatggaccgcctgcgcgcc
gcgggagccgccttcttcgccctccccatccaggaaaaggaggcctacgccaacgacccc
gccgccggccgcctgcagggctacggtagccgcctcgccaccaacgccagcgggcagcgg
gagtgggaggactacctcttccacctgctgcaacccgacgggctggccgaccacgcgctc
tggcccgcgcacccgcccgactacgtcccggccacccgcgacttcggacgccgaacacgg
gagctgaccactacgctgcttgccatcctctccatggggctcctcggcccagaacgcggc
gacgcgttagagaaggcgctcatcacccgctcccaagcagcagcagaggcagcagcggaa
cagcagcagcagcagcagcaggacctcgacctcctcctccagttcaagatcaactactac
ccgaggtgcccgcagccggagctggccgtcggcgtcgagacccacacagacgtcagcgcc
ctctccttcatcctccacaacggcgtcccgggcctccaggtgctccacggcggccgctgg
gtcacggcgcgcgacgagccgggcaccatcatcgtgcacgtgggcgacgccctcgagatc
ctcagcaacggccgctacaccagcgtcctccaccgcggcctcgtcaaccgggaggccgtg
cgcatctcctgggtcgtcttcgccgagccgccaccggacgccgttgtgctgcgcccgctg
ccggagctcgtcacgccagaccaccccgccaggttcacgccgcgcacattcaagcagcac
ctggatagcaagcttttcaagaagaaacagcaggagcagcagaaagcagacaaggatggc
aataataatggtgaccaccaccacgacgagccgccgccgcctcagactcagaccaactga

DBGET integrated database retrieval system