KEGG   Sorghum bicolor (sorghum): SORBI_04g001320Help
Entry
SORBI_04g001320   CDS       T01086                                 

Gene name
SORBIDRAFT_04g001320, Sb04g001320
Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SORBI_04g001320 (SORBIDRAFT_04g001320)
   00052 Galactose metabolism
    SORBI_04g001320 (SORBIDRAFT_04g001320)
   00500 Starch and sucrose metabolism
    SORBI_04g001320 (SORBIDRAFT_04g001320)
   00520 Amino sugar and nucleotide sugar metabolism
    SORBI_04g001320 (SORBIDRAFT_04g001320)
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SORBI_04g001320 (SORBIDRAFT_04g001320)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 467 aa AA seqDB search
MADEKLAKLREATAGLTQISDNEKSGFLSLVGRYLSGDEELIEWAKIHTPTDEVVVPYDT
LESPPEDIEATKKLLDKLAVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLIVIQIESLN
KKYGSNVPLLLMNSFNTHEDTLKIVEKYANSSIEIHTFNQSQYPRVVADEFLPWPSKGKT
DKNGWYPPGHGDIFPSLMNSGKLDLLLSQGKEYVFIANSDNLGAIVDMKILNHLIHKQNE
YCMEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDAHVNEFKSIEKFKIFNTNNLWVNLK
AIKRLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDHAIGINVPRSRFLPVKAT
SDLQLVQSDLYTLVDGFVTRNSARANPSNPSIELGPEFKKVGCFLSRFKSIPSIVELDSL
KVSGDVWFGSGIVLKGKVTITAKSGVKLEIPDGAVLENKDINGPEDL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgagaagcttgccaagctgcgcgaagccaccgccggcctcacgcagatcagc
gataatgagaagtccggcttcctcagcctcgtcggccgctacctcagcggcgacgaggag
ctcatcgagtgggccaagatccacacgcccaccgacgaggtggtggtgccgtacgacacc
ctggaatcccctcctgaagacattgaggccaccaagaagctgctcgacaagctcgccgtg
ctcaagctcaacggcggcctggggacgaccatgggatgcaccggacccaaatcggtcatc
gaagtgcgcaacggatttactttccttgacctgattgtgatccagatcgagtcactcaac
aagaagtatggcagcaatgtgccgctgcttctgatgaactccttcaacacccatgaagac
accttgaaaattgttgagaaatacgcgaattcaagcattgaaatccacacattcaatcag
agccagtaccctcgtgtggtagctgacgagttcttgccatggccgtccaagggaaagact
gacaagaatggctggtaccctcctggccatggtgatatcttcccatcactgatgaacagt
ggaaagctcgatttactactctcacagggaaaagagtatgtgttcattgcaaactcggat
aatttgggcgctattgttgacatgaagatactgaaccatttgatccacaagcagaatgaa
tattgcatggaggtcaccccgaaaactttggctgatgtaaaaggtggcacactgatctca
tacgaaggaagagttcagcttctggagattgcacaagtgcctgatgcacatgtgaatgag
ttcaaatcaattgagaaattcaagatattcaacaccaacaatctgtgggtgaacttgaag
gccatcaaacgccttgttgaagctgatgcactcaagatggagatcattccgaatcctaag
gaagtcgatggtgtgaaagttcttcagctggaaacagcagctggtgcagcaattaggttc
tttgaccacgccattggtatcaacgttccaaggtcccggttcctaccagttaaggcaaca
tcagatttacagctagtacagtctgatctatataccttggttgatggcttcgttacacgt
aattcagctagagcaaatccatcaaatccctcaattgaacttggtcctgagttcaagaag
gttgggtgcttccttagtcgcttcaagtcaatccctagcattgttgagcttgacagcttg
aaggtttctggtgatgtttggtttggttctggcattgtactgaaggggaaagtgaccatc
acagcaaaatctggcgtcaagctagaaatcccagacggagcagtgcttgagaacaaggat
atcaatggccctgaggacctttag

DBGET integrated database retrieval system