KEGG   Sorghum bicolor (sorghum): SORBI_04g001850Help
Entry
SORBI_04g001850   CDS       T01086                                 

Gene name
SORBIDRAFT_04g001850, Sb04g001850
Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SORBI_04g001850 (SORBIDRAFT_04g001850)
Translation factors [BR:sbi03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    SORBI_04g001850 (SORBIDRAFT_04g001850)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 231 aa AA seqDB search
MEDWDSEDFQPVAPVVKAEPLKNQWADEDVEEDDVKESWEEEEEEKPKPAPVEKAAAKPS
TKAPAKKGKQQASTSAAEPDEPPLSPTSEKIRQQRLVEEADFKSTTELFAKKGGEQKSLD
TFIPKSESDFAEYAELIANKLRPYEKSFHYMALLKNVMRLSMTSLKGADAKEISSSVTAI
ANEKIKAEKEAAAGKKKQGAKKKQLHIEKGDDDFIPGRGGGYDDPDEYDFM
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggaggactgggattctgaagatttccagccagttgcccctgttgtgaaagctgagcca
cttaaaaatcagtgggctgatgaagatgttgaagaagatgatgtaaaagaatcgtgggaa
gaagaggaggaggagaaaccaaagccagcgcctgtggaaaaggctgcggcgaaacctagc
actaaggctcctgctaaaaagggaaaacagcaagcatcaacaagtgctgcagaaccagat
gagccccctcttagtcccacttcagagaaaattcgccaacaaaggcttgtggaagaagct
gacttcaagtcaaccacagaactttttgcaaagaagggtggtgagcaaaagtcactagat
acttttatcccgaagtccgagagtgactttgcagaatatgcggagcttattgcaaataaa
ctgcgcccctatgagaaaagctttcactatatggctctccttaagaatgtcatgagactt
tccatgacatcgttgaaaggtgcggacgcaaaagaaatatcttcatccgtgacagcaatt
gctaacgagaagatcaaggctgagaaagaggctgcagcaggcaaaaagaaacaaggagcg
aaaaagaagcaactccacatcgagaaaggagatgacgacttcatccccggacggggtggt
ggctatgatgatccggacgagtacgacttcatgtga

DBGET integrated database retrieval system