KEGG   Sorghum bicolor (sorghum): SORBI_04g003020Help
Entry
SORBI_04g003020   CDS       T01086                                 

Gene name
SORBIDRAFT_04g003020, Sb04g003020
Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SORBI_04g003020 (SORBIDRAFT_04g003020)
Transcription factors [BR:sbi03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    SORBI_04g003020 (SORBIDRAFT_04g003020)
Mitochondrial biogenesis [BR:sbi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    SORBI_04g003020 (SORBIDRAFT_04g003020)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 1646 aa AA seqDB search
MNVGQAAHLSGQMSGQTAQMNQVPGTGVGVGVGVGVGGADGLPQHQPMQEMAALSGTDQH
FVMLRTTMREKIFEYIGRKQSSAEWRKRLPELAKRLEEILYRKFPNKNDYYNMMKGPVEP
QLQFAIKTLSAQNQHNQQNPQMTRQIASSSGYGTMIPTPGMTQGTSANSRIPYVTDNNAL
SSSGGGMVPQNANMGVSMQGPMSNGYQHLNTNIPQNSTTNNVQSTMGSVGVQRQLPHMIP
TPGFSNQQNVPSNPDYSNGTGYFNGESAVAPHMQHQKQFSSNQNSNQIQHIAGHNNSGMH
SSMLDNSSAYGLSDGHMNGGIGVHGSNMQLTNRNTAPEAYMNISPYGNSPKPLQQQFNQH
PQQRIPTSVDMAGSGSFYATGSTPLTTANSQSMNVANLQSRSRMNQMLVSNQLNIQSIQQ
QPQIKSEVLDQTEKVNFQSPQLTHDQLLRQHPMPQHQVQPNSQFVQNQYHINQQQPNPQH
QQAMLRNNSFKQSQMVSTHSMQLPEQGTLPQTELVSSQASDPGDLPSFQGQYQQRNALDN
VKGGQMLGHLSSSQNFHPSASHVSQQLLPSNPHLDDGSNAVSYVLKGSQTEQMLRPQWQP
QTMEKAPVTTNSTLEKQIQEDFCQSTMAQDGAQQPFSSDWRLSNGTATSILILQCRSPQL
NSVVRKFLRQSTEQASKQKALESRKLAQQNVPQRIMNGIEGDRMDVDPVSAEAFDDQPSV
PKRLKMHPPSPSGPENDISVVSNHHVNSGFALQETQPEQFEHNNRTAYLKREVDAKADIR
APQKPIKNSYGIDGNATTSRHNVIPGVPTEMNSHIKQENLSVDKETSETALEVKNETNDP
TDATVSKSGKPKIKGVSMTELFTPEQIREHIDSLRLWVGQSKAKAEKNQAIGHSENENSC
QLCRVEKLTFEPPPIYCSPCGARIKRNAPYYTVGTGDTRHYFCIPCYNESRGETIEVEGQ
TFPKAKLEKKRNDEETEEWWVQCDKCECWQHQICALFNGRRNDGGQAEYTCPNCYVEEVK
RGLRKPLPQSAVLGAKDLPRTVLSDHIEDRLFKRLKQEKQDRAAAAGKNIDEIPGAEGLV
VRVVSSVDKKLEVKPRFLEIFQEDNYPTEFPYKSKAVLLFQKIEGVEVCLFGMYVQEFGA
ECSFPNQRRVYLSYLDSVKYFRPEIRTVSGEALRTFVYHEILIGYLEYCKLRGFTSCYIW
ACPPLKGEDYILYCHPEIQKTPKSDKLREWYLSMLRKASKEEIVVELTNLYDHFFITMGE
CKAKVTASRLPYFDGDYWPGAAEDMINQLRQEEDDRKLQKKSKTKKIITKRALKAAGHTD
LSGNASKDAMLMQKLGETIYPMKEDFIMVHLQYSCSHCCVLMVSGRRWVCHQCRSFHICD
KCYDAEQQLEDRERHPSNSRDTHMLHPVDIVGVPKDTKDRDDILESEFFDTRQAFLSLCQ
GNHYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNVCCHDIETGQGWRCEICPDFDVCN
ACFQKGAVTHPHNLTNHPSAADRDAQNAEARQMRVQQLRKMLDLLVHASTCRSGSCQYPN
CRKVKGLFRHGMQCKTRASGGCVLCKKMWYMLQLHARACKDSDCNVPRCRDLKEHLRRLQ
QQSDSRRRAAVNEMMRQRAAEVAANE
NT seq 4941 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtggggcaggctgcccacctgtctgggcagatgtccgggcagacagcgcagatg
aatcaggttcccggcaccggtgtcggcgtcggcgttggtgttggtgttggtggcgctgat
gggctgccgcagcaccagccaatgcaggagatggcagcgctctcgggaacggatcagcat
ttcgtcatgcttcggaccactatgcgtgaaaagatattcgaatatatagggaggaaacaa
tcatcagctgagtggcggaagcggttgccagaactggcaaagcggcttgaggagatcttg
tacagaaaattcccaaacaagaatgactactacaatatgatgaagggaccagttgagccg
caattgcagtttgctattaagaccttgagcgctcagaaccaacacaatcaacaaaaccca
caaatgacaagacaaatagcatcatcctctggctatggtactatgattcctacccctggt
atgacgcaaggcaccagtgcaaattctaggattccttatgtcacggacaacaatgccctt
tcttcgtctggtggaggcatggttcctcagaatgctaacatgggtgtctcgatgcaaggt
ccaatgtctaatgggtaccagcatttaaataccaacattccacaaaattctaccacaaat
aacgtccaatctacaatgggttcagttggtgttcagcgacaactacctcatatgatccca
actccaggattcagtaatcaacagaatgtaccttcaaatcctgactattcaaatggaact
ggatatttcaacggtgagtcagctgtggcgccacatatgcagcaccagaagcaattttct
agcaaccaaaatagcaatcaaattcagcatattgcgggccacaataattctggaatgcat
tcaagcatgttggacaactcatctgcatatggtttatcagatggacacatgaatggtgga
ataggagtgcatgggtcaaatatgcagctaacaaataggaatacagcaccggaagcatat
atgaacatatccccttatggcaattcgcccaaacctttgcagcagcaattcaatcagcac
cctcagcagagaataccgacatcagttgatatggctggttccggcagcttttatgctact
ggctctacccctttaaccacagcaaatagtcagagcatgaatgttgcaaatttgcagtct
agatcaagaatgaatcagatgttggtttccaatcagttaaacattcagtctattcagcaa
cagccccagataaaaagtgaggttttggatcaaacagaaaaggtgaattttcagtcacca
cagttgactcatgatcaactactacgccagcacccaatgccgcagcatcaggtgcaacct
aattcccagtttgttcaaaatcagtatcatataaatcaacagcagccaaatccacagcat
cagcaggctatgctaaggaacaattcctttaaacagtctcaaatggtttccacccattca
atgcaactaccagaacaggggactctgccacaaactgaactggtatcttcacaagctagt
gatcctggtgaccttccaagcttccagggtcaataccagcaaagaaatgctcttgacaat
gttaaaggagggcagatgcttggtcatctatctagctctcaaaattttcatccttctgcc
tcacatgtttctcagcaattgttgccctctaatccacatcttgatgacggttccaatgct
gtaagctatgtgctgaaagggtcgcagacagagcaaatgctacgtcctcaatggcagcct
caaacaatggaaaaggctcctgtcactactaattcaacactcgaaaagcaaatacaggaa
gatttttgtcaaagcacaatggcacaagatggagcacaacaaccattttcatcagattgg
cgtctttctaatggcactgcaacttctatattgatcctgcagtgccgaagcccgcagctg
aacagcgttgtaaggaagtttttgcggcaatcaactgaacaggcatctaagcaaaaagct
cttgagtctagaaaacttgctcaacaaaatgtgcctcagagaatcatgaacgggatagaa
ggtgatagaatggacgttgacccagtgtcagctgaagcatttgatgatcaaccatctgtc
ccaaaacgtttaaagatgcatcctccatcacccagtggcccagagaatgatatctctgta
gtctccaatcatcatgtaaactcaggctttgcattgcaggaaacacagcctgagcagttt
gagcacaataacaggacagcatatctgaaacgagaggtagatgcaaaggctgacatacga
gctcctcaaaagcccataaaaaatagttatggtattgatggaaatgcgactacatcaagg
cacaatgtgattcctggtgttcccactgagatgaactctcatatcaagcaagaaaacttg
tcggttgacaaagagacaagtgaaaccgcccttgaggttaagaacgaaacaaatgatcca
actgatgcgaccgtgtctaaatcaggaaaaccaaaaataaagggcgtttctatgactgaa
ttattcactccagaacaaataagggaacatattgacagtctaaggctgtgggttggtcag
agtaaggctaaagctgaaaagaatcaagctattggtcattctgagaatgagaactcttgc
cagctctgtagagtagaaaaacttacttttgaacctccaccaatatattgttctccttgt
ggagctcggataaagcgaaacgcaccatactacactgtgggtactggcgatacacgccat
tatttctgtatcccttgttacaatgagtctcgtggtgagactattgaggttgaaggccaa
acatttccgaaggcaaagttagaaaagaaaagaaatgatgaggaaacggaagaatggtgg
gttcaatgtgacaaatgtgaatgctggcaacatcaaatttgtgctctatttaatggaaga
aggaacgatggaggacaagctgaatatacttgccccaattgctatgttgaggaggtcaaa
cgcgggctgcgcaaacctttaccacagagtgctgttcttggggcaaaagatttgccgaga
actgttcttagtgatcatatagaagatcggctatttaaacgacttaagcaggagaaacag
gaccgtgcagctgctgctggcaaaaatattgatgagattcctggagcggaaggacttgtg
gtcagagttgtttcatcagtggataagaagctggaggttaaaccacgctttttggaaatt
tttcaagaagacaactaccctacagagttcccttacaagtccaaggctgttctcttgttc
cagaaaatagaaggtgtggaagtatgtctatttggaatgtatgttcaagaatttggtgca
gaatgctctttcccgaaccagcgccgtgtttacttgtcgtacttggattctgttaagtat
ttcagacctgagattagaacagtatctggagaggccttgcgtacatttgtgtatcatgaa
attctgataggatatcttgaatactgtaagctacggggattcacaagttgttacatatgg
gcttgcccacctttgaagggtgaagattacatcttatattgccatcctgagattcaaaag
actccgaaatctgacaaactgcgtgagtggtacttatctatgcttcggaaggcttctaag
gaggaaattgttgttgagctgacaaatctatatgaccatttcttcattactatgggggaa
tgcaaggctaaggtgactgcttctcgcttgccgtactttgatggagattattggccagga
gctgcagaagatatgatcaatcaactccgacaagaagaagatgatcgcaaacttcagaaa
aagagtaagacaaagaaaattattacaaaaagagctcttaaagctgctggccacactgat
ctcagtgggaatgcttccaaggatgctatgttgatgcaaaagcttggggaaactatatat
cctatgaaggaagatttcattatggtccatttacagtattcatgtagtcactgttgtgtt
cttatggtgtctggaagacgttgggtttgtcatcaatgcagaagctttcacatctgtgac
aagtgttatgatgcagaacaacaacttgaagacagggagaggcacccgagtaatagtaga
gacacacatatgcttcatccggttgatattgtcggggtgcccaaagataccaaagataga
gatgacatcttagaaagtgagttttttgacaccaggcaggcattccttagtctttgccaa
ggaaatcattatcagtatgacacacttcgccgcgcaaagcattcgtcaatgatggtgttg
taccacctacacaatccaactgcaccagcatttgtcactacgtgcaatgtctgctgtcat
gatattgaaactggtcaaggctggcggtgtgagatttgtccagattttgatgtgtgcaat
gcttgtttccaaaaaggagcggttactcatcctcacaatttaacaaaccatccatcagct
gctgaccgtgatgctcaaaacgcagaagctcggcaaatgcgtgttcagcagctaagaaag
atgcttgatcttctggtacatgcgtcgacatgccgctctggtagttgccagtatcctaac
tgccgaaaagtcaagggactattccgtcatgggatgcagtgcaaaacgcgtgcttcagga
gggtgtgtcctttgcaagaaaatgtggtacatgcttcaactccatgcccgagcttgcaaa
gattcagattgcaatgtgccgcggtgcagagatctgaaggagcatcttagaaggttgcaa
cagcagtctgattccaggaggagggctgctgtaaatgaaatgatgaggcaaagagcggcg
gaagtcgccgcaaatgaatag

DBGET integrated database retrieval system