KEGG   Sorghum bicolor (sorghum): SORBI_04g005170Help
Entry
SORBI_04g005170   CDS       T01086                                 

Gene name
SORBIDRAFT_04g005170, Sb04g005170
Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SORBI_04g005170 (SORBIDRAFT_04g005170)
Enzymes [BR:sbi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SORBI_04g005170 (SORBIDRAFT_04g005170)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 316 aa AA seqDB search
MSGAKASVERVKDRATGLDKFVLREARGSSVEVYLYGGQVTFWKNNFGQQLLFVSDKATF
KPPKAIRGGIQICFPQLGNHGVLEQHGFARNRFWSVDESPPSFPVATSNCHIDLILKSSQ
EDLKIWPHSYEFRLRVALSPRGDLILTSRIKNISSDSKPFQFTFAYHTYFSVSDISEVRV
EGLETLDYLENLQSKNRCTEQGDAVVFESEVDKVYLSAPPKIVIIDHEKKRTFVLRKEGL
PDVVVWNPWDKKAKAMTDFGDEEYKNMLCVGPAAIEKPITLKPGEEWIGKQEICAVPSSY
SSGQLDPELIRRMHTI
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggggcgaaggcatccgtggagcgcgtgaaggaccgcgccaccggcctcgacaag
ttcgtgctccgcgaggcccggggcagctccgtcgaggtatatttatatggaggccaagtg
acattttggaaaaataacttcggtcaacaactgctttttgttagtgacaaggctactttt
aaaccaccaaaagcaattcgtggtggcatccaaatttgcttccctcaactaggtaaccat
ggagttcttgaacagcatggatttgcaaggaaccgattttggagtgtcgatgaaagtcca
ccttcttttccagttgctacttccaattgtcatattgacttgatactcaagtcatctcaa
gaggatttgaagatctggccacatagttatgaatttcgtctgagagttgctctgagtcca
aggggagatcttattcttacatctcgaataaaaaatatcagctctgatagcaagccattc
caatttacatttgcataccacacctacttttcggtgtctgacatcagtgaagtgagggtt
gaaggtttggagaccttggactatcttgaaaacttgcaatctaagaatcgttgtactgaa
caaggagatgcagttgtatttgagtctgaagtggacaaggtatatttgagtgctccacca
aagattgtgatcattgaccacgagaagaaaagaacatttgttttgaggaaagagggactt
cctgatgttgttgtttggaacccttgggacaagaaggccaaagcaatgacagatttcggg
gatgaggagtacaagaacatgctatgcgtggggcctgcagctattgagaagccaattact
ttaaagccaggtgaagagtggataggaaagcaggagatttgtgctgtaccatccagttat
agcagcggacaattggatcctgaactgattcgtcgaatgcacacaatataa

DBGET integrated database retrieval system