KEGG   Sorghum bicolor (sorghum): SORBI_04g007000Help
Entry
SORBI_04g007000   CDS       T01086                                 

Gene name
SORBIDRAFT_04g007000, Sb04g007000
Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SORBI_04g007000 (SORBIDRAFT_04g007000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 1850 aa AA seqDB search
MAPLPPRELLSVIEAALLGSAAPSPAQRVELLHAVRDAAPTFRTLLSYPGPKASDRTQVE
SKEVRLPGMPPITLDDTDVQTALKLSDELNLNEIECVRLLVDANREWVLYGREPLEIYRL
AAGLWYMERRDLITALYILLRSVALDQGLDADLMSEIEEQIQPLFNDGLRQRIISLVKEL
NREEPAGIGRPSSERYVLDFRGALVERRAIVSRERLSLSHCLTLSALIKLMSPREVKDVF
SILKDCAAEANQNSSVELQITYGVLFSLVATFISDALSPLEKALLSSSDSSFRREFHELV
MKTGNNTTIEGFVGVVRLAWSVHLMLTQDRSNSREMSDIWSCLEIVYRQNSFEFLREQVL
KTAAYQNDDEDIVYMYTGYTHKLMMCFISHPTSRDKIKEIKEKAMTALSPYGPPRSHRED
LGRNGEQDDQPTKEPFVSLLELVREIYQKEPELGNGNEELWTFVIYAGEDHTNTQTLVAF
LGLLSTLASTEVGAAKVYELLQGKTYRSVGWSTLFDCLSIYEEKFKKSIQSSANIPPDFP
EGDAQALVAYLAVLQKVVENGNPMERKKWFPDIEPLFKLLSYENVPPYLKGALRNSITAF
IKVSPLLKDAIWNYLEQYDLPVVTAPLGHHTATQVYDMRFELNEVEARRESYPSTISFLR
LINALIVEERNISDKGRRFMGIFKFVYEDVFGPFPQRAYADPLEKWELALACLEHFRMVL
SMYDIKDDDIYASVNTLAPSSIERQLPLLELLKDFMSGKVAFRNIMNIILVGVDSLINER
TTQTYGIILEKAVHLSLEIFILVMERDLALADVFRPLYQPLDVILAQSHRQIVALLEFVR
YDYLPQIQQCSIKIMGILSSRIVGLVQLLLKADVGKMVIEDYAACLEFRFDDFQVIEDTK
DDVGVLILQLLVDNISRPAPNITHLLLGFDVNGSIEQTVLKPKSHYSCLKIILDNIEKAT
KPDINALLHEFSFQLLYELCLDPLTCWPVMDLLSTKKYQFFSKLELIFSLPTDDGCQHVG
TIGVTPLPKRNSNQSLRISMLHERAWLLKMLALALHISDISSSVYKEACLAILYHTFGQC
AENFQSSSLFDSRALTSISDVPAKRNKVLDLLEVLQFRCPDISMKYPQLLSNLGIESKIE
EILRNSATSENGGVYYYSERGDRLIDLDAFHEKLLQMSQELNPQLSESEKAGLKESVHHL
LKWAWRYNKNLEEQAAQLHMLTGWSQIVEVAVSRRMSLFEERSQLLFELLDASLNATTSP
DCSVKMAYVLTNVSLTCMAKLRDERFICPTGTDSDAVTCLDIILSKQLPNAACNSLLFKL
VMATLRNESSETLRRRQYALLLSYFQYCSSILDSDVPPSVFRFLLLEEQEGDDEDITLQK
VLKEHNELAHANFSIIRKEAQAIVDLVTRDAVHGSEAGKAISFYVLDALISIDHEKYFLN
QLQSRGILRSCLSDVTNYLSKDSSLASESSQRFCTVDAQFSLLLRISHHYGKHGAQILLS
MGALQNLSSCNLMGGQKKGNPRAISKIVKERTGEIDKKRSLITPVLRIVTSFTSLVDSAD
FLEVKNKIVREIVDFTKQHQSVFNSILRENMTGANLLTLEQLNMAVSILSKVWAYEENEE
CSYIQDLFSLMHSLFSLDFGSLNFMQSPNIIENHKSELIAFGLCFSLVSYLYVLATKKNM
RFQVSYENNSDQQHPTLQMVSDLLNSVTLALERVGEEKYMLLNKIHDLNELSRKEVDEII
KVCMKQDCISPNDDIRKRRYIAMIDLCCMAGNRDQLITLLLQITECAVTILLIHFQDDAS
AKGLSSFSDELLPVLERLEHLKEDKVGCNLKLFHRSVTTLKEMTIRTMTL
NT seq 5553 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcttcctccgcgcgagctcctctctgtcatcgaggcggcgctgctgggctcc
gcggcgccgtcgccggcgcagcgcgtggagctcctccacgccgtccgcgacgccgccccc
acgttccgcacgctactctcctatccggggccgaaggcgtctgatcggactcaggtggag
agcaaagaggtgcggctcccaggcatgccgcccatcactctcgatgacaccgacgtgcag
actgcccttaagttaagtgatgaactcaatctgaatgagattgagtgtgttcgtttgcta
gttgatgctaacagagagtgggttttgtatggtcgagagccattggaaatatatagactt
gcagctggcctatggtacatggagagaagggatcttataactgctctgtacattctgttg
cgatctgttgcacttgaccaaggtcttgatgctgatctgatgtctgaaattgaggagcaa
atccagcctttatttaatgatggtcttcgacaacggataatttcccttgtgaaggagctg
aaccgggaagaaccagctggaattggccgaccaagctctgagcgttatgtgcttgatttc
agaggagctcttgtggaaagaagggcaattgtctcaagagagagattaagtttgagccac
tgcctcactctttctgcacttattaaactaatgagccccagagaggttaaggatgtattt
tcaatattgaaagactgtgcagctgaagcaaatcaaaatagtagtgtggagctccagatc
acctatggagttctgttctctcttgtggcaacttttatttctgatgccctaagtcctctt
gagaaagcattattgtcatcgtctgattcctcatttagacgtgaatttcatgaacttgtg
atgaagacaggtaacaatacgactattgaagggtttgttggtgttgtgagacttgcatgg
tctgtacatttgatgctaactcaagatcgaagtaattcaagagaaatgtcagatatttgg
tcatgtctggaaattgtctatcgtcaaaattcttttgagtttttgcgggagcaagttttg
aaaacagctgcataccagaatgatgatgaggacattgtctacatgtacactggctacact
cacaaactaatgatgtgctttatttcccaccctacttccagagataagataaaggaaatt
aaggagaaagcaatgactgccctcagtccatatgggccaccgcggagtcatcgggaagat
cttggtagaaatggggaacaagatgatcagcctactaaggagccttttgtatccctgctg
gaactagttagagaaatctatcagaaagagcctgagctagggaatggtaatgaggaattg
tggacctttgttatatatgcaggagaagaccacaccaacacacaaactcttgtggccttc
cttggacttctcagtactttggcttccaccgaagttggtgctgccaaagtctatgagctt
ctccagggaaaaacttaccgttcagtgggttggagcactttgtttgattgcttatctatc
tatgaggagaagttcaaaaaatcaattcaatcttctgcaaacataccacctgattttcct
gagggggatgcacaggctcttgttgcatatttagctgttcttcagaaggtggtggaaaat
gggaatcctatggaacgcaagaagtggttccctgacattgaacctttattcaagcttctc
agctatgaaaatgtgcctccatacttgaagggggctctgcgaaattcaataactgcattt
atcaaagtgtcacccctactaaaagatgctatttggaattatcttgagcaatatgatctt
cctgtggttacggctccattaggtcaccatacagcaacacaggtctatgatatgaggttt
gagttgaacgaagtagaagcgaggagggagagttacccctcaaccatatctttcctcaga
ttgatcaatgcacttattgtagaagaaagaaacataagtgacaaaggccggaggttcatg
ggtatctttaagtttgtttatgaggatgtctttggtccttttcctcagagagcttatgct
gaccccctggaaaaatgggagctcgcacttgcctgcttggagcatttccgcatggttttg
agcatgtatgacataaaggatgatgatatttatgcttctgtgaacacattagctccttcc
tctatcgagagacagctccctctgctagaactactcaaagatttcatgagtgggaaagtt
gctttccggaatattatgaacatcatattagtgggtgttgactctcttatcaatgagcga
actacccagacatatggtatcattttggagaaagctgtccatctatctcttgaaatattt
attcttgtcatggagagagatctggctcttgctgatgtttttcggccactctaccagcca
ttggatgttatattagctcaaagtcatagacaaattgtagcattgctagagtttgtacga
tatgattatcttccccaaattcaacagtgttctatcaaaattatgggcatcctgagttct
agaatagttggtttggtacagttgcttttgaaagctgatgttggaaaaatggtaatagaa
gattatgctgcttgcttggagttccggtttgatgattttcaggtcatagaagacacaaaa
gatgatgttggagttctaatactgcagttgcttgttgacaatatttctcgtccagctcca
aacattacacatttgctcttgggatttgatgtcaatggatccattgagcaaacggttcta
aaaccaaaatcccactacagttgtttgaagataatccttgacaatattgaaaaagcgaca
aagccagacataaatgccttactgcacgaattcagttttcagcttctctatgagttatgt
cttgatcctttaacttgttggcctgtgatggatctcctgagtacaaagaagtaccagttc
ttttctaagttagaactcatattttccttgcccactgatgacggatgtcagcatgttgga
accatcggagtgacaccgctcccgaaaaggaacagtaaccaatctcttcgtatcagcatg
ctccatgagagggcatggttgctaaagatgttagcactggcattacatatatccgatata
tcatcatctgtatacaaggaagcctgcttggctattctttatcatacttttggtcagtgt
gctgagaacttccagagctcaagtttgttcgattctcgtgctttgactagcatcagcgat
gtaccagcaaagaggaataaggttttggacttgcttgaggttctacagttcagatgcccg
gacatttcaatgaagtatccacagctgctttccaacctgggaattgaatcaaagattgaa
gagatcctaaggaactctgcaacttctgaaaacggtggtgtatattattattcagagaga
ggtgatcgactgattgatcttgatgctttccatgaaaaacttctccagatgtcacaagaa
ttgaacccacaattaagcgagtctgagaaagccggactaaaagaatcagttcatcatttg
ctgaaatgggcttggcgatataataaaaatcttgaagaacaggctgcccaacttcacatg
ttaactggctggtcacagattgttgaagttgctgtatcaagaaggatgtcattatttgag
gagcgttctcagctattgtttgagctgcttgatgcttcattgaatgccacgacatctcca
gattgttcagtgaaaatggcatatgttttaacgaatgtatcgttgacctgtatggctaaa
ctgcgggatgaaagattcatatgcccaactggtacagattctgatgcggttacttgcctt
gacattattttgtcaaagcagctaccaaatgcagcttgtaactcattgctattcaagctt
gtgatggcaacgctaagaaatgaatcatctgaaaccttgagaagacggcaatatgcatta
ttactgagttattttcagtattgtagtagcattcttgactctgatgtccctccatcagtt
tttcggttcttgctactggaggagcaagagggtgatgatgaggacatcactcttcaaaag
gttctcaaggagcacaatgagttagcacatgccaacttttccatcataaggaaggaagct
caagctatcgttgatttggttactagggatgctgtccatggtagtgaagctgggaaagca
atttccttttatgttcttgatgcattaattagtattgaccatgaaaagtatttcttaaat
caacttcaaagtcgagggattcttagatcatgtctgagtgatgttacaaactatttgtca
aaggattcgtcattggcatcagaatcttcacagcggttttgcactgtcgatgctcagttt
tcattactgctgagaataagtcatcattatggcaaacatggtgctcagattctgttgtcc
atgggtgctttacaaaatctttcatcatgcaacctcatgggtgggcagaaaaagggaaat
ccaagggcaatctccaaaattgtaaaagaacggactggtgaaattgacaagaagaggtca
cttattacacctgtactgcgaatagtcacctcttttacatcacttgtggactcggctgat
tttcttgaggtgaagaacaagattgtacgagagatagtggacttcacaaagcagcatcag
tcggtttttaatagcattttaagggagaacatgactggagctaatttgctcacattggag
cagcttaacatggcggtttctattctcagcaaggtttgggcgtatgaggaaaatgaggaa
tgcagctatattcaagatctattttccttgatgcattctctttttagcctcgattttggg
tctctaaattttatgcaatcaccaaacattattgagaatcataagtcagaattgatagca
tttggtctttgcttcagccttgtctcttacctttatgttctggctacaaagaagaacatg
cgatttcaagtttcgtatgaaaataatagtgatcagcagcacccaacactccaaatggtt
tctgatcttctgaattcagtaacacttgccctagaaagagtaggtgaagaaaaatatatg
cttttaaacaagatccatgacttgaatgagttgtccagaaaggaggttgatgagataata
aaagtatgcatgaagcaagattgcatctctcccaatgatgacatccgtaagaggaggtac
attgcaatgatagatttgtgttgcatggctggcaaccgagaccagcttataacccttcta
ctgcaaataacggaatgtgccgttactattctccttattcattttcaggacgatgcttct
gcaaaaggtctttcttcattttctgatgaacttcttcctgtgctggagagactagagcat
ttgaaagaggacaaagttggatgtaatctgaagttgttccacagatccgttactacactt
aaggagatgaccatcagaaccatgaccctatga

DBGET integrated database retrieval system