KEGG   Sorghum bicolor (sorghum): SORBI_04g008750Help
Entry
SORBI_04g008750   CDS       T01086                                 

Gene name
SORBIDRAFT_04g008750, Sb04g008750
Definition
hypothetical protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SORBI_04g008750 (SORBIDRAFT_04g008750)
Peptidases [BR:sbi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SORBI_04g008750 (SORBIDRAFT_04g008750)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 966 aa AA seqDB search
MLQPREADVPALFLVFIVLPVVAYFLLGRWHDAASKKARVSVLAHRAAEEAYREETMACP
DIIPPGPSLRTMPYFRPAPSLRQEYHECATCHAPAKTRCSRCKSVRYCSGKCQIVHWRQG
HKETCQKWLGSGSSSFGGSSTEATEQMPFLTNLNSPLPGGDIHLRDMNFDTLSEPSFPTT
DGYNLDTDPFPADRSNMDRSNQGIHMSENGAVGVSFEKNNYNAADEIHSPEILSGNKVSN
NYFGSDAISGNGDATYPAKSNAHQPSSCAPDMRKQSKASITVYQPDTGVYLTSDMVSSCE
GSYVSASEPLQRSLSSGRTIGKANVVNKRPPHPSSKVVSAQKSQDRVSTSYQNDGHEKNP
YNKNEQRSTPTCESSQPTSSNLQKFGASKVEVLKKPSKFLKTSLVGLINDNKRNKVLFPY
EDLVKFFQYEARGISPRGLFNCGNSCYANAVLQCLMCTKPLMIYLLLRLHSKDCSSKNWC
LMCELEQYASTLRESGGPLSPSRILSNLRNIGCRLGGGTQEDAHEFLRHLVMSMQAACLD
GLGGEKHVEPSLQETTLIQQMFGGRLKSKVKCLRCYHESERYENIMDLTLEIHGWVESLQ
DALTQFTAPEDLDGDNMYKCGRCSAYVKARKQLSVHEVPNILTLVLKRFQSGKYGKINKC
VTFPDMLDMVPFVTGSGDNPPLYFLYAVVVHVDTENASFSGHYISYVKDMQGTWLRIDDS
EVQVVSVNQVMSEGAYMLFYLRSFPRPPRIYIEKGLPVTSVKRHTSKSSKGSKHERKQTS
ANDQAYGVYDFRPDGEGYMQDHHAELRSRDFHHADDAFADSVSTDFSEATSSEWSLFTSS
DESSFTTESTRDSFSVVDYGDNAGLDPISSIFGPSYAPEHPPGNFVSCTRFSPSNPQTRY
FSESTGFVSDSSMPAHPSGIVHRGRYPDRACASSAEPLASAHQRSGYGRYPLSRDGFVQT
SGFCQM
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atgctccaaccaagggaagctgatgtgcctgcactctttcttgtcttcattgtacttccc
gtggtagcttattttcttcttgggagatggcatgatgctgcaagtaagaaggcaagggta
agtgtgcttgcacatcgagctgcagaagaagcctatagagaggaaacaatggcatgccca
gacattattccgccagggccttccttgagaactatgccctatttcagacctgcaccttca
ttaagacaggaataccatgaatgtgcaacttgccatgcccctgcaaagactcgttgctcc
agatgcaagtctgttagatactgctctgggaagtgtcaaatagtacactggagacaagga
cataaggaaacatgccaaaaatggcttggtagtggttctagcagctttggtggatctagc
actgaggctactgagcagatgccgttcttgactaacttaaattcacctcttccgggtggt
gacattcacttgcgtgacatgaactttgatactttatcagaaccatcctttcccacaact
gatggctacaatctagatactgatccatttccggcagacagaagcaacatggatagatca
aatcaagggattcatatgagcgaaaatggtgctgttggtgtatcttttgaaaagaataat
tataatgctgctgatgaaatccactctccagagattttatctggcaacaaggtgtcaaac
aactattttggttcagatgcaataagtggtaatggggatgcaacttatcctgccaaaagt
aatgcacatcaacctagcagttgtgctcctgacatgagaaaacagtcaaaagcaagcatc
acagtttatcagcctgacacgggtgtctatttaacttctgacatggtcagttcttgtgag
gggtcatatgtttctgccagtgagccactgcaaaggagcttgtcgtctggaagaactatt
gggaaagcaaatgtggtgaataagaggcccccacacccatcaagtaaggtggtctcagca
cagaagtcacaggatagggtgtctacatcatatcaaaacgatggtcatgagaagaatcct
tacaacaaaaatgaacaaagatctacccccacatgtgaatcaagtcaaccaacaagtagc
aatctacaaaagtttggagcatccaaggttgaagttttaaagaagccttcaaaatttctc
aaaaccagccttgtgggattgatcaatgataataagaggaacaaggtattgttcccatat
gaagatcttgtcaagttttttcagtatgaagcacggggtatttctcctagaggtcttttc
aattgtggaaacagctgctatgctaatgctgttcttcaatgtctcatgtgcacaaagcca
ctgatgatctaccttcttctgagattgcattctaaagattgctcttcaaaaaattggtgc
cttatgtgtgaacttgagcaatatgcttcaactttacgtgaaagtggtggacccttatct
ccaagtagaattctttctaatctgaggaatattggatgtcgcttgggtggtggaactcag
gaagatgctcatgagtttttaaggcatcttgtgatgtctatgcaagcagcttgcttggat
gggctgggtggtgagaagcacgttgaaccaagtttgcaggaaacaacactgatacaacag
atgtttggtggccgtcttaaatccaaggttaagtgcctcagatgctatcacgagtctgaa
agatatgagaatataatggatcttactttggagattcatggctgggtagagtccttgcaa
gatgctttgacacagttcactgctcctgaagatttagatggtgataatatgtataaatgt
ggaaggtgttctgcctatgttaaagctaggaagcaactgagtgtgcatgaggtgccaaac
atattgacacttgttcttaaaagatttcagtcaggaaaatatggcaagatcaataaatgt
gttactttccctgatatgttggacatggttcctttcgtgactggatctggtgacaatccc
cctctttatttcttgtatgccgtggttgtacatgtggatacagaaaatgcatcattctct
gggcactatatatcttacgtcaaagatatgcagggtacatggttgagaattgatgattca
gaggtccaggttgtatcagtgaatcaagttatgtcagaaggtgcatatatgcttttctac
ttgaggtcttttccccgaccaccaagaatatacattgagaaggggctgcccgttacctct
gtaaagcgtcacacttcaaaatcttccaagggctctaaacatgagcgcaagcagacttct
gcaaatgatcaagcatatggggtttatgattttagacccgatggcgaaggctacatgcaa
gatcatcatgcagagttgagatccagagatttccatcatgccgatgatgcctttgcagac
tcagttagcacagacttctcggaagctacctcaagtgagtggtcgttgtttaccagctct
gacgagtcctcatttaccactgaaagcacaagagattcattcagtgttgtggattatgga
gacaacgctggcctggatccaatttcctctatatttgggccaagttatgctccggagcac
cctcctggcaatttcgtctcatgtacaaggttctcaccttccaatccacaaacaaggtac
ttctcagagagcacaggcttcgtctcggactcttccatgccggcccaccctagcggcatt
gtacatagaggaaggtatccagatagggcatgtgcctcttcagccgaaccgctcgcttcg
gcgcatcagcggagtgggtacggtcggtatccccttagtcgagatggttttgttcaaaca
tctgggttttgccaaatgtaa

DBGET integrated database retrieval system