KEGG   Sorghum bicolor (sorghum): SORBI_04g010370Help
Entry
SORBI_04g010370   CDS       T01086                                 

Gene name
SORBIDRAFT_04g010370, Sb04g010370
Definition
hypothetical protein
Orthology
K10527  
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SORBI_04g010370 (SORBIDRAFT_04g010370)
  Lipid metabolism
   00071 Fatty acid degradation
    SORBI_04g010370 (SORBIDRAFT_04g010370)
   00592 alpha-Linolenic acid metabolism
    SORBI_04g010370 (SORBIDRAFT_04g010370)
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SORBI_04g010370 (SORBIDRAFT_04g010370)
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     SORBI_04g010370 (SORBIDRAFT_04g010370)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SORBI_04g010370 (SORBIDRAFT_04g010370)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 727 aa AA seqDB search
MAAGSIRVTMEVGADGVALITIANPPVNALHPIIIAGLKDKYAEAMRRDDVKAIVLTGAG
GKFCGGFDINVFTKVHQTGDVSLMPDVSVELVSNMMEEGKKPSVAAIQGLALGGGLELIM
GCHARISTPEAQLGLPELTLGIIPGFGGTQRLPRLVGLPKAIEMMLQSKFITAKEGKERG
LIDALCSPDELIKTSRLWALEIANCRKPWMRSLGRTDRLGSLSEARAVLNAARQQAMKIA
PNMPQHQACLDVMEEGILYGGQAGVLKEAKVFKELVIAPTSKALVHVFFAQRSTTKVPGV
TDVQLKPRPIRKVAVIGGGLMGSGIATSLLVSNISVVLKEVNPQFLQRGEKMIAGNLEGL
VKRGSLTKDRMHKAMSLLKGALDYSDFKDVDMVIEAVIEKIPLKQSIFSDIEKICPKHCI
LATNTSTIDLNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQAILDLITVGKI
IKKVPVVVGNCTGFAVNRTFFPYTQGSHLLVSLGIDVFRIDRVISSFGMPMGPFQLQDVA
GYGVALAVKGIYADAFGERNLNSNLVDLMVKDGRQGKVNGKGYYIYEKGGKPKPDPSVKH
VLEEYQKQANTMPGGKPVTLTDQDILEMIFFPVVNEACRVMDENVVIRASDLDIASVLGM
GFPKYRGGLVFWADTVGAPYIHSKLSKWAEIYGPFFKPSSYLEQRAKSGVPLSAKGASQQ
GSARSRM
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggggtcgatccgggtcaccatggaggtgggcgccgacggcgtcgcgctcatc
accatcgccaacccgcccgtcaacgcgctccaccccatcatcatcgccgggctcaaggac
aagtacgcggaggccatgcgccgtgacgacgtcaaggccatcgtgctcactggtgctgga
ggcaagttctgtggaggatttgatatcaacgtcttcacaaaggttcatcagactggggat
gtatcacttatgccggacgtatccgtcgagcttgtgtcaaacatgatggaagagggcaaa
aaaccttctgttgcagccattcaaggtcttgcgctgggtggtggcctagagttgattatg
ggttgtcatgctcggatatctactcctgaagctcaacttggattgccagagctaaccctt
ggcatcatccctggatttggaggtacccagcgtctgccgaggcttgtaggtctacccaaa
gcgattgaaatgatgctgcaaagtaagttcattacggcaaaggaagggaaggaacgtggt
ttgattgatgctctttgctctcctgatgaattgataaagacatcacgtctttgggctctg
gaaattgctaattgccgtaaaccttggatgagatctcttggcagaacagataggcttgga
tcactatctgaagctcgtgctgtattaaatgcagcaagacagcaagcaatgaagattgca
ccaaacatgccacagcaccaggcctgccttgatgtaatggaagaaggcatattatatgga
ggtcaagctggtgttttgaaggaagccaaggttttcaaggagctggtgatagcaccaaca
tcaaaggctcttgtccatgttttctttgcacaacgttcgacaacaaaggtgccaggtgta
actgatgttcaactgaaaccaaggccaattagaaaagttgcagttattggtggtggtctg
atgggctctggaattgctacatcacttcttgttagcaacatttctgttgtgctcaaggaa
gtaaaccctcagtttctgcaaaggggagagaaaatgatagcaggcaatcttgagggcctg
gtcaaaagaggttcgcttacaaaggataggatgcacaaggccatgtcgcttctcaagggt
gctttggattattcagatttcaaggatgttgatatggttattgaggctgttatcgagaag
attcctttgaagcaatcaatattttctgacattgagaaaatctgtccaaaacattgcata
cttgcgacaaacacatccaccattgatttgaatgttgttggcgagaagacaaattctcaa
gatagaattataggggctcactttttcagccctgctcatattatgcctttgcttgaaatt
gtccggacggagaagacatcaccacaagctatccttgatctcatcaccgttgggaagata
ataaagaaagtcccagttgtggtcggcaactgcacaggatttgcagtcaaccgtacattt
tttccttacacacagggttctcatcttctagttagtcttggtattgatgttttcagaatt
gatcgagtaataagtagcttcggcatgccaatgggaccttttcaactccaagatgtggct
gggtatggagtggccttggcagtaaaaggtatctacgctgatgcctttggagaaagaaat
ttgaactctaaccttgtggacttgatggtaaaggatggacgacagggaaaggtgaatggc
aaaggttactacatttatgagaagggcgggaagccaaagccagaccctagtgttaagcat
gtgcttgaggagtaccaaaagcaggcaaacacaatgcctggtggaaagcctgttacttta
acggatcaagatattttggagatgattttcttcccagttgtgaatgaggcatgcagggtt
atggatgaaaatgttgtaattcgagcttctgatcttgatattgcttctgttcttggaatg
ggctttcccaaatacaggggtggtcttgtcttctgggctgacactgttggagcaccttac
atacattcgaagctaagcaagtgggctgaaatttatggtcccttcttcaaaccatcatcg
tatttggaacaacgagctaaaagtggtgtaccattgagtgcaaaaggagcatcacagcaa
ggttcagcgaggtcacgcatgtga

DBGET integrated database retrieval system