KEGG   Sorghum bicolor (sorghum): SORBI_04g017400Help
Entry
SORBI_04g017400   CDS       T01086                                 

Gene name
SORBIDRAFT_04g017400, Sb04g017400
Definition
hypothetical protein
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    SORBI_04g017400 (SORBIDRAFT_04g017400)
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     SORBI_04g017400 (SORBIDRAFT_04g017400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 454 aa AA seqDB search
MAKPKPSSAGAKSAAAAAAPAPPATVHSALVTYTSMLALLSLCPPFVILLWYTMVHADGS
VVRTYEHLREHGVLEGLKAIWPMPTLVAWKIIFGFGLFEAVLQLLLPGKRFEGPISPAGN
VPVYKANGLQAYAVTLITYLGLWWFGIFNPAIVYDHLGEIYSALVFGSFVFCILLYIKGH
VAPSSSDSGSSGNVIIDFYWGMELYPRIGKYFDIKVFTNCRFGMMSWAVLAVTYCIKQYE
MNGRVADSMLVNTALMLIYITKFFWWESGYWCTMDIAHDRAGFYICWGCLVWVPSIYTSP
GMYLVNHPVNLGPQLALSILLAGMLCIYINYDCDRQRQEFRRTNGKCSVWGKAPSKIVAS
YQTTKGETKTSLLLTSGWWGLSRHFHYVPEILSAFFWTVPALFNHFLPYFYVIFLTILLF
DRAKRDDDRCSSKYGKYWKTYCNKVPYRVIPGIY
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcccaagccttcctccgccggcgccaagtcggcagcggctgccgccgcccct
gcgccgcctgccacagtgcactcagcgctggtcacctacacctccatgctcgcgctcctc
tccctctgcccgcccttcgttatcctcctgtggtacacgatggtgcacgcggacggatcg
gtggtgcggacttacgagcacctcagggagcacggcgtgctcgaggggctcaaggccatc
tggcccatgcccaccctcgtcgcatggaagatcatcttcggcttcggactcttcgaggcc
gtcctgcagctgctgctccctgggaagcgcttcgaagggcccatctcgcctgccgggaac
gtgccggtctacaaggcaaatggcttacaagcatatgcagtgaccttgataacttacctc
ggtttgtggtggttcggtatatttaaccctgcaatagtgtatgatcacttgggggagata
tactctgctcttgtctttggaagctttgtgttctgtattttgctctacataaagggtcat
gtagctccatcttcatctgactctggatcctcagggaatgtgataattgacttctactgg
ggtatggagctgtaccctcggattggcaagtactttgatatcaaagtcttcacaaactgt
cgttttggtatgatgtcctgggctgttcttgctgtaacctactgcataaagcagtatgaa
atgaatggcagagttgctgattctatgcttgtaaatactgcacttatgttgatctatatc
actaagttcttttggtgggaatctggatattggtgtactatggacattgctcatgataga
gctggtttctatatctgctggggatgcttggtatgggttccatccatatatacttcgcct
ggaatgtaccttgtaaaccaccctgtgaatttgggtccccagttagcactctcaattctt
ctagctggaatgttgtgcatatacataaactatgattgtgaccgtcagcgccaagaattt
agacggacaaatgggaaatgctcagtctggggcaaggctccatctaagattgttgcttct
tatcagactacaaagggagaaactaaaaccagtcttctcttgacttctggatggtggggc
ttgtcacgtcacttccactatgtcccagagattctatctgcgtttttctggactgttcca
gctcttttcaatcacttcctaccatacttctatgtgatcttcttgactatattattgttt
gaccgagcaaagagggatgatgaccggtgctcatcaaagtacgggaagtactggaagact
tactgcaacaaagtaccatacagagtcattcctggcatttactga

DBGET integrated database retrieval system