KEGG   Sorghum bicolor (sorghum): SORBI_04g021370Help
Entry
SORBI_04g021370   CDS       T01086                                 

Gene name
SORBIDRAFT_04g021370, Sb04g021370
Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SORBI_04g021370 (SORBIDRAFT_04g021370)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SORBI_04g021370 (SORBIDRAFT_04g021370)
   00620 Pyruvate metabolism
    SORBI_04g021370 (SORBIDRAFT_04g021370)
   00640 Propanoate metabolism
    SORBI_04g021370 (SORBIDRAFT_04g021370)
Enzymes [BR:sbi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SORBI_04g021370 (SORBIDRAFT_04g021370)
Lipid biosynthesis proteins [BR:sbi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SORBI_04g021370 (SORBIDRAFT_04g021370)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 707 aa AA seqDB search
MGTANGQQPAAEGASSDKLRHVESMSELPSGAGKISGINAVVLGESLAAEENDLIFPSSD
FSANALVSSPKQYREMYERSIKNPAGFWSEIAETFYWKEKWNPAEVCSENLDVTKGPVQI
NWFKGGKTNICYNAVDRNIESGNGDKIAMYWEGNEPSQDGKLTYSELLEKVCQLANYLKS
LGVGKGDAVIIYLPMLLELPIAMLACARIGAVHSVVFAGFSADSLAQRIVDCKPKLVITC
NAVKRGVKPIFLKDIVDVALVESEKNGVSVGLCLTYENQSAMKREDTKWQPERDVWWQDV
VTKFPTKCDVEWVDAEDPLFLLYTSGSTGKPKGVLHTSGGYMVYTATTFKYAFDYKPTDI
YWCTADCGWITGHSYVTYGPLLNGATVLVFEGTPNYPDSGRCWDIVDKYNVTIFYTAPTL
VRSLMRDGTEYVTRYSRKSLRVLGSVGEPINPSAWRWFYNIVGDSRCPISDTWWQTETGG
FMITPLPGAWPQKPGSATFPFFGVQPVIVDEKGQEIEGECSGYLCIKKSWPGAFRTLYGD
HERYETTYFKPFAGYYFTGDGCSRDKDGYHWLTGRVDDVINVSGHRIGTAEVESALVSHP
QCAEAAVVGVEHEVKGQGIYAFVTLVDGVPYSEELRKSLIMTVRNQIGAFAAPDKIHWAP
GLPKTRSGKIMRRILRKIAARQLDELGDISTLAEPAVVDQLIALSDC
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgggcacggccaacggccagcagccggcggcggagggcgcttcctctgacaagctccgc
cacgtcgagtccatgtcggagctgccctccggcgccggcaagatctccgggatcaacgcc
gtcgtgctcggggagtcgctcgccgccgaggagaacgacctcatcttccccagctccgac
ttctctgccaacgctctcgtctcctctccgaaacagtatcgggagatgtatgagaggtcc
atcaagaacccggctgggttctggtcggagattgccgagacattttactggaaggagaag
tggaaccctgccgaagtctgctcggagaacctcgatgtcaccaagggacccgtccagatc
aactggttcaagggagggaaaactaacatatgttacaacgctgttgaccgcaacatcgag
tctggcaatggggacaagattgcaatgtactgggagggtaatgagcccagtcaggatggg
aagctcacctattccgagctcctggagaaggtttgccagcttgcaaattacttgaagagc
cttggtgtcggcaagggtgatgctgttattatctacttaccaatgctactggagcttccc
attgccatgcttgcctgtgcccgcattggtgctgtccactcggttgtgtttgctggcttc
tcagcagattctctagcccaaaggattgttgattgcaagccgaagcttgtcatcacgtgc
aatgctgtgaagcggggagtcaagcccatctttctcaaagatatagtggatgtggctttg
gtcgaaagtgagaagaatggagtctctgtaggtctctgcttgacgtatgaaaatcagtca
gccatgaagagggaagacacaaaatggcaaccagaaagggatgtttggtggcaggatgtc
gtgaccaaatttccaaccaaatgtgatgtggaatgggtggatgccgaggatccattgttc
cttttgtacacaagtggcagcacagggaagccaaagggtgtgttgcatacttctgggggc
tacatggtgtatactgcaacaacctttaagtacgcatttgactacaagccaactgacata
tactggtgcactgcagactgtggctggattactggacatagttatgtaacatatggtcct
ctcctgaatggtgctacggttctcgtttttgaagggactccgaactaccctgattcaggc
cgatgctgggacattgtcgacaagtacaatgtgacaatattttatactgccccaactctt
gttcgttcactcatgcgtgatggcactgagtatgtcacacgttactctcgaaagtctcta
cgagtcctgggaagtgttggtgagccaatcaatcctagtgcatggagatggttctacaat
attgttggggattcccggtgccccatatcagacacctggtggcaaactgaaactggcggt
ttcatgatcacccctttgcctggcgcctggcctcagaaaccgggttctgcaacctttcct
ttctttggtgttcagccagtcattgttgatgagaaagggcaagagattgaaggggaatgc
agtggatatctttgcataaagaaatcatggcctggggctttccggactctgtatggagat
catgagagatatgagaccacatacttcaaaccatttgctgggtactatttcactggtgat
ggttgcagcagagacaaagatggttatcactggctgactggaagagtagatgatgtcatc
aatgtcagtggacaccgaatcggcactgccgaggttgagtcagctttggtgtcacatcca
cagtgtgcagaggctgctgttgttggtgttgagcatgaggtcaaaggtcaaggaatttat
gcttttgtaactttggtggatggtgttccgtatagtgaggaactacgaaaaagccttata
atgacagtgcgcaaccagattggggcatttgcagctcctgacaagatccactgggcacca
ggacttcctaaaacccggagtggcaagatcatgcgaaggattttgcgtaaaattgctgca
cggcaactggatgaacttggggacataagcacccttgctgaacctgctgtagttgaccag
cttattgcgctcagcgattgctag

DBGET integrated database retrieval system