KEGG   Sorghum bicolor (sorghum): SORBI_04g021540Help
Entry
SORBI_04g021540   CDS       T01086                                 

Gene name
SORBIDRAFT_04g021540, Sb04g021540
Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SORBI_04g021540 (SORBIDRAFT_04g021540)
Enzymes [BR:sbi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SORBI_04g021540 (SORBIDRAFT_04g021540)
Exosome [BR:sbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SORBI_04g021540 (SORBIDRAFT_04g021540)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 803 aa AA seqDB search
MAAFAVSGAALGGAVRAPRLTGGEEGSLVFRRTGPFLTRAGGARVGGSGTHGAMRAAAAS
SRKAVVVAEGENDGLASKADSAQFQSDELEVPDVTEETMCDAGVADAQALNRVRVVPPPS
DGQKIFQIDPMLQGYKYHLEYRYSLYRRIRSDIDEHEGGLEAFSRSYEKFGFNRSAEGIT
YREWAPGALSAALVGDFNNWDPNADRMSKNEFGVWEIFLPNNADGTSPIPHGTRVKVRMD
TPSGIKDSIPAWIKYSVQAPGEIPYDGLYYDPPEEVKYVFKHPKPKRPKSLRIYETHVGM
SSPEPKINTYANFRDEVLPRIKKLGYNAVQIMAIQEHSYYGSFGYHVTNFFAPSSRFGTP
EDLKSMIDRAHELGLLVLMDVVHSHASSNTLDGLNGFDGTDTHYFHSGPRGHHWMWDSRL
FNYGNWEVLRFLLSNARWWLEEYKFDGFRFDGVTSMMYTHHGLQVTFTGNFNEYFGFATD
VDAVVYLMLVNDLIHGLYPEAVTIGEDVSGMPTFALPVQDGGVGFDYRMHMAVADKWIEL
LKQSDEAWKMGDIVHTLTNRRWLEKCVTYAESHDQALVGDKTIAFWLMDKDMYDFMALDR
PATPTIDRGIALHKMIRLITMGLGGEGYLNFMGNEFGHPEWIDFPRGPQRLPSGKFIPGN
NNSYDKCRRRFDLGDADYLRYRGMQEFDQAMQHLEQKYGFMTSDHQYISRKHEEDKMIVF
EKGDLVFVFNFHCNNSYFDYRIGCRKPGMYKVVLDSDAGLFGGFGRIHHAAEHFTTDCSH
DNRPHSFSVYTPSRTCVVYAPAE
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgttcgcggtctctggagcggcgctcggtggggccgtaagggctccccgactc
accggcggcgaggaggggagtctggtcttccggcgcaccggccccttcttaactcgtgca
gggggtgctagagttggaggttccgggacgcacggggccatgcgcgcggcggccgcgtcg
tccaggaaggcggtcgtggttgccgaaggcgagaacgacggcctcgcatcgaaggctgac
tcggctcagttccagtcggatgaactggaggtaccagacgttactgaagagacgatgtgc
gatgccggcgtggctgatgctcaagccttgaacagagttcgagtggtcccaccaccgagc
gatggacaaaaaatattccagattgaccccatgctgcaaggctataagtaccatcttgag
tatcggtacagcctctataggagaatccgttcagacattgatgagcatgaaggaggcttg
gaagccttctcccgtagttatgagaagtttggatttaatcgcagcgcggaaggtatcacc
tatcgagaatgggctcctggagcactttctgcagcattggtgggcgacttcaacaactgg
gatccaaatgcagaccgtatgagcaaaaatgagtttggtgtttgggagatttttctgcct
aacaatgcagatggtacatcacctattcctcatggaactcgtgtaaaggtgagaatggat
actccatcagggataaaggattcaattcctgcctggatcaagtactcagtacaggctcca
ggagaaataccatacgatgggctttattatgatcctcctgaagaggtaaagtatgtgttc
aagcatcctaaacctaaacgaccaaaatcattgaggatatatgaaacacatgttggaatg
agtagcccggaaccgaagataaacacatatgcaaactttagggatgaggtcctcccaaga
ataaaaaaacttggatacaatgcagtgcaaataatggcaatccaagagcactcatattat
ggaagctttggataccatgtaactaatttttttgcaccaagtagtcgttttggtactcca
gaagatttgaagtctatgattgatagagcacatgagcttggtttgctagttctcatggat
gtggtccatagtcatgcgtcaagtaatactctggatgggttgaatggttttgatggtacg
gatacacattattttcatagtggtccacgaggccatcactggatgtgggattctcgctta
ttcaactatgggaactgggaagttttaagatttcttctctccaatgctagatggtggctt
gaggaatataagtttgatggtttccgctttgatggtgtgacctccatgatgtacactcac
cacggattacaagtaacatttacggggaacttcaatgagtattttggctttgccaccgat
gtagatgcagtggtttacttgatgctcgtaaatgatctaattcatggactttatcctgag
gctgtaaccattggtgaagatgttagtggaatgcccacatttgcccttcctgttcaagat
ggtggggtaggttttgactatcggatgcacatggctgtggctgacaaatggattgaactt
ctcaagcaaagtgatgaagcttggaagatgggtgatattgtgcacacactaacaaataga
aggtggttggagaagtgtgtaacttatgctgaaagtcatgatcaagcattagtcggtgac
aagactattgcattttggttgatggacaaggatatgtatgatttcatggcccttgataga
cctgcaactcctaccattgatcgtgggatagcattacataagatgattagacttatcaca
atgggtttaggaggagagggctatcttaatttcatgggaaatgagtttggacatcctgaa
tggatagattttccaagaggtccacaaagacttccaagtggtaagttcattccagggaat
aataacagttatgacaaatgccgtcgaagatttgacctgggtgatgcggactatcttagg
tatcgtggtatgcaagagtttgatcaggcaatgcaacatcttgagcaaaaatatggattc
atgacatccgatcaccagtatatttctcggaaacatgaggaggataagatgattgtgttt
gaaaagggagatttggtatttgtgttcaacttccactgcaacaacagctattttgactac
cgtattggttgtcgaaaacctgggatgtataaggtggtcttggactcggacgctggacta
tttggtggatttggcaggatccatcacgcagcagagcacttcactaccgactgttcacat
gataacaggccccattcgttctctgtttatacaccaagcagaacctgcgtcgtctatgct
ccagcggaatga

DBGET integrated database retrieval system