KEGG   Sorghum bicolor (sorghum): SORBI_04g023830Help
Entry
SORBI_04g023830   CDS       T01086                                 

Gene name
SORBIDRAFT_04g023830, Sb04g023830
Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SORBI_04g023830 (SORBIDRAFT_04g023830)
   00052 Galactose metabolism
    SORBI_04g023830 (SORBIDRAFT_04g023830)
Enzymes [BR:sbi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SORBI_04g023830 (SORBIDRAFT_04g023830)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 394 aa AA seqDB search
MARAPPPPPLHRLPALLAALCLAVAVCFSGVVENAAAATLAADRTGRKMVGVHELRMGDF
SIKVTNWGATLMSVILPDSKGNLGDVVLGYDTVAEYVNGSAYFGGLIGRVANRIAGARFV
LDGKAYRLYRNDGNNSLHGGHRGFSKVIWTVKEHVGGGDSPYITLYYHSFDGEQGFPGDL
DVYVTYRLSSPYALSVRMNATAAESRSRATPVNLAHHAYWNLGGHGSGPILGETVQLFAS
RYTPVDAATLIPTGALAPVAGTPYDFRAPAPVGARLQPDLPHGLAGYDTNYAVDHDDDDD
DGAAPPLRPVARVWDGATGRAMELWADQPGVQFYTSNGLAGVRGKGGSVYGRYGALCLET
QGFPDAVNHPSFPSQIVRPGQVYKHDMVFKFSFA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaagagctcctcctcctcctcctctgcaccggctccctgctcttctcgccgccctg
tgccttgccgtggcggtttgcttctccggcgtcgtcgaaaatgctgcagcggcgacccta
gcggcggacaggaccggcaggaagatggtcggtgttcacgagctcaggatgggagatttc
tccatcaaggtcaccaactggggggcgactctcatgtccgtcatcctccccgactccaaa
gggaacttgggcgacgttgtgctcggctacgacaccgtcgctgaatatgtcaacggcagc
gcctacttcgggggtctgatcggccgcgtggccaacaggatcgccggcgctcggttcgtg
ctggacggcaaggcctaccgcctctaccgcaacgacggcaacaactcgcttcacggtggc
caccgggggttcagcaaggtgatatggacggtgaaggagcacgtcggcggcggcgactca
ccgtacatcacgctctactaccatagcttcgacggggagcaagggtttccgggcgacctg
gacgtgtacgtgacgtaccgactctcgtccccgtacgcgctgagcgtgcgcatgaacgcc
acggcggcggagagcaggagcagggccaccccggtgaacctggcgcaccacgcctactgg
aacctgggcggccacggcagcgggcccatcctcggcgagacggtgcagctcttcgcgtcg
cggtacacgccggtggacgccgccacgctcatcccgacgggcgcgctggcgcccgtggcc
ggcacgccctacgacttccgcgcgccggcgcccgtgggcgcgcgcctgcagcccgacctg
ccgcacggcctcgccggctacgacaccaactacgccgtggatcacgacgacgacgacgac
gatggcgccgcgccgccgttgcggccggtggcgcgcgtctgggacggcgcgacggggcgg
gccatggagctgtgggcggaccagcccggggtgcagttctacaccagcaacgggctcgcg
ggcgtcaggggaaagggcggcagcgtgtacgggcggtacggcgcgctgtgcctcgagacg
caggggttccccgacgccgtgaaccacccgagcttcccgtcgcagatcgtcaggccagga
caggtgtacaagcatgacatggtctttaagttctccttcgcctag

DBGET integrated database retrieval system