KEGG   Sorghum bicolor (sorghum): SORBI_04g030340Help
Entry
SORBI_04g030340   CDS       T01086                                 

Gene name
SORBIDRAFT_04g030340, Sb04g030340
Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Exosome [BR:sbi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SORBI_04g030340 (SORBIDRAFT_04g030340)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 155 aa AA seqDB search
MAPKAEKKPASKKPAEEEPSEKAAPAEKAPAGKKPKAEKRLPAGKSSAGKEGGEKKGRKK
GKKSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAAESAKLARYNKKPTI
TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggcagagaagaagccggcgtcgaagaagcccgcggaggaggagccctcg
gagaaggcggctccggcggagaaggcccccgcggggaagaagcccaaggcggagaagcgg
ctcccggcgggcaagtcgtccgccggcaaggagggcggcgagaagaaggggaggaagaag
ggcaagaagagcgtggagacctacaagatctacatcttcaaggtcctgaagcaggtgcac
ccggacatcggcatctcctccaaggccatgtccatcatgaactccttcatcaacgacatc
ttcgagaagctggccgcggagtccgccaagctcgcccgctacaacaagaagcccaccatt
acctcccgcgagatccagacctccgtccgcctcgtcctccccggggagctcgccaagcac
gccgtctccgagggtaccaaggccgtcaccaagttcacctcctcttag

DBGET integrated database retrieval system