KEGG   Sorghum bicolor (sorghum): SORBI_04g031200Help
Entry
SORBI_04g031200   CDS       T01086                                 

Gene name
SORBIDRAFT_04g031200, Sb04g031200
Definition
hypothetical protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SORBI_04g031200 (SORBIDRAFT_04g031200)
Peptidases [BR:sbi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SORBI_04g031200 (SORBIDRAFT_04g031200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 697 aa AA seqDB search
MAEQDGAAGQSPPDSVPGGAAENGDQNTKQHQPFFSMCQPLRTVSYSNSWDGVCAPAANE
NNHTSGLNSMADEHTITASTPLGSKQPQSEGISGTSYREDNSCSPHSINKEVSLVQDVME
MEQSMDGVDVPHGGTSEQPEPLATEQPDSFDEIDIWGAQDNQQVLPLNSKQWNSNIGETC
DAEDMHIPLSVSYRRQPKSVIIRMGSVLSVPLKNMLMNQFEELSSDFRPGQQEDAHEFLR
CLLDNLHKCTLDPKSKGKDSSFDEESIVKEIFGGQLRSHLSCCECGHSSETFEPFLDLSL
EIDQVDHLVDALQSFTKVEHIGDSENKLTCESCNAQVCKNKQLTLHRAPDVIAFHLKRFT
TLDNSVEKIDKHVVYPLEVDLKPFYSNPDAAGELKYDLYGVVEHSGLPNYGHYVCAIRSS
PSTWQDILQVDSITDSSALNQEAYILFYVRQGKFPWFSSLLEGKDALQVENTRGTSPVSV
LENIDANCSNSSGGGSSSSSGDKLEKNEASQLEETEKDEMSRYKTPFLPEKPSKRSPLGA
SNSNNKIDENKPSRASLQNDAARCLRSLETTNLDKPSTPRCSKRLALSSDNESSVFEFED
FGLMFLLVSFIDEEVETLHPNMKLQPKVKKAKAASASKAVKGPCIDQNALHLMRGMTSTR
RKDLMECIKQQNAKHESRRCPASDPLDKKKRKVVLQY
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcaggacggcgccgcggggcagagcccgcccgactccgttccgggtggtgct
gctgaaaatggggatcagaatactaagcagcatcagccatttttctcgatgtgccagcca
cttcgcactgttagctactcgaattcgtgggatggggtttgtgctcctgctgctaatgaa
aataaccacactagtggcttgaactcaatggcggatgaacacaccataactgcatctact
ccccttggaagcaagcaacctcaatctgagggcatatctggtacatcgtacagggaagac
aattcatgttcaccacattcaattaataaggaagtcagtttggtgcaagatgtcatggaa
atggaacaatcaatggatggagttgatgtgccacatggaggaacaagtgagcagccagag
ccccttgccacagagcagcctgattcatttgatgaaatagacatatggggtgcccaagat
aatcagcaagtgttgccccttaacagcaagcaatggaactctaatattggtgaaacttgt
gatgctgaagatatgcatattcctttgtccgtttcttatagaaggcaacctaaatctgtg
ataataaggatgggttctgttctttctgtgcccttaaagaacatgctgatgaatcaattc
gaagagttatcttcggattttagaccaggacagcaagaagatgcacacgaattcctacgt
tgcttgcttgataacttgcataagtgtactcttgatcccaagtcaaagggcaaggactca
tcctttgacgaagaaagtatagttaaggagatttttggaggacaactaagaagccattta
tcttgctgcgagtgtggtcacagctcagagacatttgagcccttcctggatctaagcttg
gagattgatcaggtcgatcacctggtagatgctttgcaatcttttaccaaggtagagcat
attggggactctgaaaacaagctcacttgtgaaagttgcaatgctcaagtttgtaagaac
aagcagcttacacttcatagagcaccggatgttattgcatttcatctcaagcgttttaca
acccttgacaattccgttgagaagattgacaaacatgtggtgtaccctctggaggttgat
ttgaagccgttctacagcaacccagatgctgcgggggagctgaaatatgatctttatggt
gttgttgagcattctggattacccaactatggccattatgtctgtgccattcgttcttca
ccaagcacatggcaagacattttgcaggttgattctattactgattcaagtgcactaaac
caagaagcatatattctattctatgttaggcagggcaaatttccatggttctcgagtttg
ttagaaggcaaggatgccctacaagttgagaatacccgtggcacatctcctgtgtcagtt
ttggaaaatatagatgcaaactgttcaaattcttctggaggaggcagtagcagtagttct
ggtgacaagttggagaaaaatgaagccagccaattagaggagacagagaaagatgaaatg
agtcggtacaaaacaccattccttcctgagaaaccatctaagagaagtccacttggtgct
tccaacagcaataataaaatagatgaaaataagccatccagggcttctctccaaaatgat
gcggctagatgtctccgcagtctagaaactaccaatctggataagccctctactccacgg
tgctccaaacgactggcactgtcctctgataatgagtctagcgtgtttgagtttgaggac
tttgggctcatgtttctccttgtctcatttatagatgaggaagtggagactttacatcca
aacatgaaattgcaaccgaaggtgaagaaagctaaggctgcatctgcatctaaagctgtg
aagggtccgtgtattgatcagaatgcattacatttgatgaggggcatgacatccacacga
agaaaagatctaatggagtgcataaaacagcaaaatgcaaagcacgagtctcgcagatgc
cctgcaagtgaccctctggacaaaaagaaaagaaaggtggttcttcagtactag

  All links  
No link information was found.   
DBGET integrated database retrieval system