KEGG   Sorghum bicolor (sorghum): SORBI_04g034920Help
Entry
SORBI_04g034920   CDS       T01086                                 

Gene name
SORBIDRAFT_04g034920, Sb04g034920
Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sbi00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 497 aa AA seqDB search
MRALSHGSSMRAHVALALAALVLAGDALHPSLAAAGFDYKDALSKTIIFLEAQRSGKLPP
NNRVKWRGDSALDDGKLANVDLTGGYYDAGDNVKYGLPLAFTVTTLAWTVLAFKPELEQT
KELEHVHEAIRWGTDYLLKCAARKNKLWVQVGDPNLDHQCWVRPENMKAPRTLYEIDEKT
PGTEIAAETAAAFAASSMVFRNDKKYSRALLNKAKLLFLFAKAHQGSYDGECPFYCSYSG
YNDELLWAATWLYLATKRQVYADFITHEAISSSVAEFSWDLKFPGAQVLLAEFNMTSGGG
AQNFKVQADNFVCAVLPDTPFHQVFITPGGVIHLRDGANTQYVTSTSFLFVVYSDLLLRT
GQSVMCGNQPVAPARLREFARQQMDYLLGANPRHSSYVVGFGANSPTQPHHRGASTPVLP
PGTDVNCGLSFGEWMAPDRPNPNELTGAIVGGPDKNDGFVDKRGNSSYTEPCTYINSLAI
GPLAALAVRGAQLVATH
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcactgagccacggcagcagcatgcgcgcccacgtcgccctggccctcgcggcg
ctggtgctggccggcgacgccctgcacccgtcgctggccgccgccggcttcgactacaag
gatgccctcagcaagaccatcatattcctcgaggcgcagcgctccgggaagctgccgccc
aacaaccgcgtcaagtggcgcggcgactccgcgctcgacgacggcaagctcgccaatgtg
gatctcaccggcgggtactacgacgccggcgacaacgtcaagtacgggctgccgctggcg
ttcacggtgaccacgctcgcatggacggtgctggcgttcaagcccgagctggagcagacc
aaggagctggagcacgtgcacgaggccatcaggtggggcaccgactacctgctcaaatgc
gccgccaggaagaacaagctgtgggtgcaggtcggcgaccccaacttggaccaccagtgc
tgggtgcggccggagaacatgaaggcgccgcggacgctgtacgagatcgacgagaagacg
cccgggacggagatcgccgccgagacggccgccgccttcgccgcctcctccatggtgttc
cgcaacgacaagaagtactcgcgcgcgctcctcaacaaggccaagctgctgttcctgttc
gccaaggctcaccagggcagctacgacggcgagtgccccttctactgctcctactcgggc
tacaacgacgagctgctgtgggctgcgacgtggctttacctggcgacgaagcgtcaggtg
tacgcggacttcatcacccacgaggccatctcgtcgagcgtggccgaattcagctgggac
ctcaagttccccggcgcgcaggtgctcctggccgagttcaacatgacgtccggcggcggc
gcgcagaacttcaaggtgcaggcggacaacttcgtgtgcgcggtgctcccggacacgccg
ttccaccaggtgttcatcaccccgggcggcgtgatccacctccgggacggcgccaacacg
cagtacgtgacgagcacgtcgttcctgttcgtggtctactccgacctgctgctgcggacg
gggcagtcggtgatgtgcgggaaccagcccgtggcgccggcgcggctgcgggagttcgcg
cggcagcagatggactacctgctgggcgccaacccgcggcacagctcctacgtcgtgggc
ttcggcgccaactcgcccacgcagccgcaccaccgcggggcgtcgacgcccgtgctgcca
cccggcaccgacgtcaactgcgggctcagcttcggggagtggatggcgcccgacaggccc
aaccccaacgagctcaccggcgccatcgtcggcgggcccgacaagaacgacggcttcgtg
gacaagcgcggcaactcctcctacaccgagccatgcacctacatcaactcgctcgcaatc
ggcccgctcgccgcgctcgccgtccgcggcgcgcagctcgtcgcaacgcactga

DBGET integrated database retrieval system