KEGG   Sorghum bicolor (sorghum): SORBI_04g036210Help
Entry
SORBI_04g036210   CDS       T01086                                 

Gene name
SORBIDRAFT_04g036210, Sb04g036210
Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
sbi  Sorghum bicolor (sorghum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 175 aa AA seqDB search
MGNASSMLTQYDIEEVQEHCNYLFSQQEIVSLYERFCQLDRSAKGFISEDEFLSIPEFSL
NPLSKRLLRMVDGLNFKDFVAFLSTFSAKASLRQKIELIFKVYDIDGKGKITFKDLLEVS
RDLTGSFMSEEQREQVVTKVLEEAGYTRDCAFSLEDFIQIIDHPGLKMEVEVPID
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggggaacgcgtcgtctatgctgacccagtacgacatcgaggaggtgcaggagcactgc
aactaccttttctcgcagcaggagatcgtgtcgctgtacgagcgcttctgccagctcgac
cgcagcgccaagggcttcatctccgaggacgagttcctctccatcccggagttctccctc
aacccgctctccaagaggttgctccgtatggttgatggattgaacttcaaggattttgtt
gcctttctttctactttcagtgcaaaggccagtcttcggcagaagatcgagctaatattc
aaggtttatgacattgatggcaagggaaaaataaccttcaaggatctgctagaggtttca
cgggacctaacagggtcattcatgtccgaagaacaaagagagcaagtagtaactaaggta
ctggaagaagcagggtacacaagagattgcgcgttctcattggaagattttatccagatc
atcgaccatcctggccttaagatggaggtggaagtgccaatcgactag

DBGET integrated database retrieval system