KEGG   Sorghum bicolor (sorghum): SORBI_04g036470Help
Entry
SORBI_04g036470   CDS       T01086                                 

Gene name
SORBIDRAFT_04g036470, Sb04g036470
Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SORBI_04g036470 (SORBIDRAFT_04g036470)
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SORBI_04g036470 (SORBIDRAFT_04g036470)
Transfer RNA biogenesis [BR:sbi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SORBI_04g036470 (SORBIDRAFT_04g036470)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 447 aa AA seqDB search
MGSLRVAGLAWAAAASPEWGVRRSRRCCRGVPLARPRAAAASLGAGQLRVGTEHGWLWDC
RSGGARDYAREMEVAVRIVQVACTLCQRVQDSLLRPGPDAGGGGRVHAKLDRSPVTVADW
GVQATVSWLLSSSFHDENISIVAEEDDETLSSSDGATLLESVVEAVNGCLVEAPNYGLRS
PEKDLGAHDVIQAIRKCSSTGGPKGRFWVLDPVDGTLGFVRGDQYAIALALIEDGEVILG
VLGCPNYPMKKEWLNYHQKYYRLMSKVAPPPLGSWNKGCVMYAQKGCGQAWMQPLVHDFG
KLNWHHPREIQVSSISDPISATFCEPVEKANSSHSFTAGLAQSVGLRNQPLRVYSMVKYA
AIARGDAEIFMKFARAGYKEKIWDHAAGVVIIKEAGGVVTDAGGHPLDFSRGVYLEGLDR
GIIACSGALLHRRILDAVDASWNSSTL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcctccgcgtcgccggcttggcatgggccgctgccgcctcgccggaatgggga
gtgcgccgcagccgtcgctgctgccgcggggtgccgctggcccgcccccgcgcggcggcg
gcctccctcggggcggggcagctccgggtcgggacggagcacgggtggctctgggactgc
cgcagcggcggcgcgagggattacgccagggagatggaggtggcggtgcgcatcgtgcag
gtcgcctgcaccttgtgccagcgcgtgcaggactcgcttctccgccccggccccgacgcc
ggcggcggcggccgcgtccatgccaagcttgaccgctcccccgtcaccgtcgctgattgg
ggtgttcaagcaacagtaagctggctgctttccagttcctttcatgatgagaacatatct
atcgttgccgaagaagatgatgagacactgtctagtagtgatggtgcaactttgcttgaa
tctgttgttgaggctgtcaatggctgcctggttgaagctcctaactatgggctgagatcc
cctgagaaagatctcggagctcatgatgttattcaagccatacggaaatgcagctcaact
ggaggccctaaaggaagattttgggtgcttgatcctgtcgacggcacccttggttttgtg
agaggggaccaatatgctattgctcttgccttgattgaagatggagaagttatacttggt
gttcttgggtgcccaaattatccaatgaagaaggagtggctcaactatcatcaaaagtac
tacaggttgatgtctaaggttgctcctcctccactggggtcctggaataagggttgtgtg
atgtatgcccagaaaggttgtggccaagcttggatgcagccactggtccatgacttcggt
aagctaaattggcaccacccaagggagattcaagtatcatccatcagtgatccaatctca
gctacgttctgtgaaccagttgagaaagccaactcaagccattccttcacagcaggactt
gctcaaagtgtaggattaaggaatcaacctctgcgcgtgtacagcatggtgaaatatgct
gcaatagcacgaggtgatgctgagatcttcatgaaatttgcaagagctggatacaaagag
aagatatgggatcatgctgcaggggtggttatcattaaggaggctggtggagtggtcaca
gatgctggaggccacccattggacttctcaaggggtgtttacctggaaggtttggataga
ggcataatagcttgttctggagcattgcttcatcgtagaattttagatgctgttgatgcg
agttggaactcatcaacactatga

DBGET integrated database retrieval system