KEGG   Sorghum bicolor (sorghum): SORBI_04g038190Help
Entry
SORBI_04g038190   CDS       T01086                                 

Gene name
SORBIDRAFT_04g038190, Sb04g038190
Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SORBI_04g038190 (SORBIDRAFT_04g038190)
   03420 Nucleotide excision repair
    SORBI_04g038190 (SORBIDRAFT_04g038190)
   03430 Mismatch repair
    SORBI_04g038190 (SORBIDRAFT_04g038190)
   03440 Homologous recombination
    SORBI_04g038190 (SORBIDRAFT_04g038190)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 278 aa AA seqDB search
MMPLSQPDFSPSQFTASQNAAADSTTPSKMRGASSTMPLTVKQVVDAQQSGTGEKGAPFV
VDGVEMANIRLVGMVNGKVERTTDVTFTLDDGTGRLDFIRWVNDASDSSETAAVQNGMYV
AVIGSLKGLQERKRATAFSIRPITDFNEVTLHFIQCVRMHIENTKLKAGSPARTSSSMGV
SVSNGFSESSTPTSLKSNPAPLTGGGSGSDTDLNKQVLHFFSEPANLESEHGVHVDEVYK
QFKQLPKDKIKEAIAFHVDAGHLYSTIDDFHFKSALTD
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatgccattgagccaacccgacttctcgccgtcgcagttcaccgcctcccagaatgcc
gccgccgactccaccacgccttccaagatgcgcggggcgtccagcaccatgccgctcacc
gtcaagcaggtcgtcgacgctcagcagtctggcaccggcgagaagggcgctccgttcgtc
gtggatggcgtcgagatggctaacattcgacttgtggggatggtcaacggcaaggtggag
cggacgaccgatgtcacattcacgctcgatgacggcaccggccgcctcgatttcatcaga
tgggtgaatgatgcttcagattcttctgaaactgctgctgttcaaaatggtatgtacgtc
gcggtcattggaagcctcaagggacttcaagagaggaagcgtgctactgctttctcaatc
aggcctataactgatttcaatgaggttacgctgcatttcattcagtgtgttcggatgcat
atagagaacacgaaattaaaggctggcagtcctgcacgaaccagttcttctatgggagtg
tcagtctcaaatggattcagtgaatcaagcacaccaacatctttgaaatcaaatccagca
ccattgaccggtggaggaagtggatctgatactgatttgaacaagcaggtgctgcatttt
tttagtgaaccagcgaaccttgagagtgagcacggggtgcatgttgatgaagtatacaag
cagttcaaacaactgccaaaggataagatcaaggaggctattgctttccatgtggacgcc
gggcatctttactcaacaattgatgacttccacttcaagtcagctttaaccgattga

DBGET integrated database retrieval system