KEGG   Sorghum bicolor (sorghum): SORBI_05g000450Help
Entry
SORBI_05g000450   CDS       T01086                                 

Gene name
SORBIDRAFT_05g000450, Sb05g000450
Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    SORBI_05g000450 (SORBIDRAFT_05g000450)
Exosome [BR:sbi04147]
 Exosomal proteins
  Proteins found in most exosomes
   SORBI_05g000450 (SORBIDRAFT_05g000450)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 1162 aa AA seqDB search
MMSQMEGGCPVDYNTITDLFLQRNMIREATAFLLDVLKPNLPEHAFLQTKVLEINLVTYP
NVADAILANGMFSHYDRPRIAQLCEKAGLYLRALQHYSELPDIKRVIVNTHAIEPQALVE
FFGTLSREWALECMKDLLLVNLRGNLQIVVQAAKEYSEQLGVDACIKLFEQFKSYEGLYF
FLGSYLSSSEDPDIHFKYIEAAARTGQIKEVERVTRESNFYDAEKTKNFLMEAKLPDARP
LINVCDRFGFVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPEDFIKGLI
LSVRSLLPVEPLVDECEKRNRLRLLTQFLEHLVSEGSQDVHVHNALGKIIIDSNNNPEHF
LTTNPFYDSRVVGKYCEKRDPTLAVVAYRRGQCDDELINVTNKNSLFKLQARYVVERMDG
DLWDKVLQPENEYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIELLEKIVL
QNSAFSGNFNLQNLLILTAIKADPSRVMDYVNRLDNFDGPAVGEVAVEAQLYEEAFAIFK
KFNLNVQAVNVLLDNIRSIERAEEFAFRVEEDAVWSQVAKAQLREGLVSEAIESFIRADD
AAHFLDVIRAAEEANVYDDLVKYLLMVRQKAREPKVDGELIFAYAKIDRLSDIEEFILMP
NVANLQNVGDRLYDEELYEAAKIIYAFISNWAKLAVTLVKLKQFQGAVDAARKANSAKTW
KEVCFACVDAEEFRLAQICGLNIIVQVDDLEEVSEYYQNRGCFNELIALMESGLGLERAH
MGIFTELGVLYARYRPEKLMEHIKLFSTRLNIPKLIRACDEQQHWKELTYLYIQYDEFDN
AATTIMNHSPDAWDHMQFKDVCVKVANVELYYKAVHFYLQEHPDLINDMLNVLALRLDHT
RVVDIMRKAGQLHLVKPYMVAVQSNNVSAVNEALNELYVEEEDYERLRESVDMHDNFDQI
GLAQKLEKHELLEMRRIAAYIYKKAGRWKQSIALSKKDNMYKDCMETCSQSGDRELSEDL
LVYFIEQGKKECFASCLFICYDLIRPDVALELAWMNNMLDFAFPYLLQFIREYTSKVDDL
VKDKIESQKEERAKEKEEKDLVAQQNMYAQLLPLALPAPPMPGMGGPPPMGGMGMPPMGG
MGMPPMGPGPMPAFGMPPMGSY
NT seq 3489 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcacaaatggagggaggctgcccagtagattataatacaataactgatcttttc
cttcagaggaatatgatacgagaggcaacagcttttctgttggatgttctgaaaccaaac
ttgccagagcatgcttttcttcaaaccaaggttttggagataaacttagtgacttacccg
aatgttgctgatgccattcttgctaatggtatgttcagtcattacgaccgccctcgtatt
gctcagctgtgtgaaaaggctggtctgtacttgcgagctctccagcattactcagagttg
cctgatatcaagcgtgtcattgtaaatacccatgccattgaaccacaggcacttgttgag
ttctttggtaccttgtcaagggagtgggctttggagtgcatgaaagaccttctactggtt
aatctgaggggaaatcttcagattgttgtgcaggctgcgaaagaatactctgagcagcta
ggggttgacgcttgcatcaaattatttgaacaattcaaatcttatgagggcctttacttt
ttcttgggatcctatctgagctccagtgaggacccagatatccatttcaagtacatagaa
gcagctgcaaggactggacagatcaaagaagttgaacgtgtaactagagagtcaaacttc
tatgatgccgagaagacaaagaactttttgatggaagcaaaactacctgatgctcgtcca
ctgattaatgtttgtgaccgctttggttttgtgccagatctcactcactatctgtacacc
aacaacatgcttcgatatatcgaaggctatgttcagaaggtgaatcctgggaatgctcca
ttggtagtggggcaactacttgatgatgagtgccctgaagattttatcaagggtttgatt
ctctctgttcgttctctccttcctgttgagcctctggttgatgaatgtgagaagaggaac
cgcctacgtttgctcactcaattcttggagcacttagtgagtgaaggtagccaagatgtg
catgtccataatgctcttgggaaaatcatcattgacagcaacaacaatcctgagcatttc
cttactaccaacccattttacgattctcgtgttgtgggcaaatattgtgaaaagcgggat
cctacacttgccgttgttgcttacagacgtgggcagtgtgatgatgaacttattaatgtc
actaacaaaaactcattattcaagctgcaagctaggtatgtggttgagagaatggatggt
gatctgtgggataaagttcttcagcctgagaatgaatatagaaggcaactcattgaccaa
gtggtttcgactgcattacctgagagcaagagccctgagcaagtgtctgctgctgttaag
gctttcatgactgctgacctgccacatgaactgattgagcttcttgaaaagattgttctt
cagaattctgctttcagtggaaatttcaatctgcagaacctgctcatcttgactgctatc
aaggcagatccatccagagtcatggactatgtcaacagactcgataactttgatgggcct
gctgttggagaagttgctgttgaagcacaactgtatgaggaggcttttgctatattcaag
aagttcaacttaaatgtgcaggctgtcaatgttctcttggacaacatccggagcatagaa
agagccgaggaatttgcttttcgtgttgaagaagatgctgtttggagccaggttgccaaa
gcccagttacgtgaaggtctggtcagtgaagcaattgagtccttcattcgcgcagatgat
gctgcacacttccttgatgtcatccgtgctgctgaagaagctaatgtgtacgatgattta
gtgaagtaccttctgatggtaaggcaaaaagcacgggaacccaaagtcgatggagaactc
atctttgcatatgctaagattgacaggctcagtgacattgaggagttcattcttatgcca
aatgttgccaaccttcaaaatgtcggtgaccgtctgtatgatgaagaactatatgaagct
gcaaagatcatctatgctttcatctcgaactgggctaagctggctgttaccctggttaag
ctgaagcagttccaaggtgctgtggatgctgctcgcaaggctaacagtgccaaaacatgg
aaggaggtctgctttgcttgtgttgacgctgaggagttccgtcttgcacaaatatgtggt
ctcaatattattgttcaggttgatgacttggaagaagtcagtgaatactaccagaataga
ggatgcttcaatgaacttattgctctcatggagagtggtcttggacttgaacgtgcacac
atgggcatcttcacagaattgggagttctatatgctagataccgccctgagaagcttatg
gagcacatcaaacttttctccacccgtcttaatattcctaagcttattcgagcttgtgat
gaacagcagcactggaaagaacttacctacctgtacatacagtatgatgaatttgacaat
gctgccaccaccattatgaaccactctccagatgcatgggatcatatgcagttcaaggat
gtttgcgttaaagttgcaaatgttgagctatattacaaggcagttcacttctatttgcaa
gagcatcctgatctcattaatgatatgctaaatgtgcttgcacttcggttagatcatacc
agagttgtagacataatgcgcaaggctggccaattgcatcttgtgaaaccatatatggtt
gcagttcagagtaacaatgtctctgctgtgaatgaagccttgaatgagctttacgttgaa
gaggaggactatgagagactccgggaatcagttgatatgcacgacaactttgaccagata
ggtcttgcccagaagcttgagaagcatgaattgcttgaaatgaggaggattgctgcctac
atttacaagaaggctggcaggtggaagcaatccattgctctatcaaagaaagacaacatg
tacaaggattgcatggagacatgctcacaatctggcgaccgtgaactgtcagaggacttg
cttgtctatttcattgagcagggtaagaaagaatgctttgcatcctgcctcttcatttgc
tacgacttgatccggccagatgtcgctcttgagcttgcatggatgaacaacatgttggac
tttgccttcccatacctgttgcagttcatccgtgagtacactagcaaggtggatgattta
gtgaaggacaaaattgagtcgcagaaggaagaaagagccaaagagaaggaggagaaagat
cttgtggctcagcagaacatgtatgcccaactgcttcctcttgctttgcctgctccgcca
atgcctggcatgggtggtccacctccgatgggtgggatgggcatgcctccaatgggtgga
atgggtatgccgccgatgggccctggtccgatgccagcattcgggatgccaccaatggga
agctactga

  All links  
No link information was found.   
DBGET integrated database retrieval system