KEGG   Sorghum bicolor (sorghum): SORBI_05g000820Help
Entry
SORBI_05g000820   CDS       T01086                                 

Gene name
SORBIDRAFT_05g000820, Sb05g000820
Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
sbi  Sorghum bicolor (sorghum)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 1236 aa AA seqDB search
MKTGCVALVLCLNISVDPPDVIKISPCARMECWIDPFSMLAPKALESIGKTLHSQYERWQ
PKARYKLQLDPTVEEVKKLCNTCRKYARSERVLFHYNGHGVPKPTSNGEIWVFNKSYTQY
IPLPITDLDSWLKTPSIYVFDCSAAGIIVKAFLERLDWSSTSSASSQKDCILLAACEAHQ
MLPQSAEFPADVFTACLTTPIKMALHWFCKRTLLHGSLDHSLIDQIPGRQNDRKTLLGEL
NWIFTAITDTIAWNVLPHGLFQRLFRQDLLVASLFRNFLLAERIMRSANCSPVSYPMLPP
THQHHMWDAWDMAAEICLSKLPQLIADPNAEFQPSPFFTEQLMAFEVWLDHGSEDKKPPE
QLPIVLQVLLSQSHRFRALVLLGRFLDMGPWAVDLALSVGIFPYVLKLLQTSAMELRQIL
VFIWTKILSLDKSCQVDLVKDGGHGYFIRFLDSLDAFPEQRAMAAFVIAVIVDGHRTGQE
ACMNAGLIDVCLRHLQPENPHAQTEPLLLQWLCLCLGKVWEDFPEAQLHGLQTNAPEIVI
CLLSEPQPEVRAAAVFALGNLLDNTLNGSDDDSDDDEKVKAEINVVRSLLQMSSDGSPLV
RSEVAIALTRFASGHNKHLKSVAAEYWKPQSNSLLKSLPSLANISNPSNVYSPNNSIGPV
LRVGSDSGAAGRDGRISTSSPIATSSIMHGSPQSDDSSQHSDSGLLLRENASNGGLSYTA
PRPVDNVIYSQFISTMCSISKDPDPRIATIGRRALSLIDVEQVVMKNTRFNSGGPHRVET
SASNYGMARSSSWRDMNSGSISMKFMTPPVSPPQHDYLIGLRRVCSMEFGQHPINSPDGL
ADRLLSSAAGLSNREPLPQSTIYNWSCGHFSRPLLTVSDDNEETNARREEKERIALDYIT
KCQRSSCKMTSQIASWDTRFELGTKAALLLPFSPIVVAADESEQIRVWNYDDALPVNSFQ
NHKLSDRGLSKLLLINELDESLLLAASSDGNVRIWKNFAQKGGQKLVTAFSSVQGHRAAG
RSIVIDWQQQSGYLYASGDMSSILVWDLDKEQLLSTIQSTADNAISSLSASLVRSGHFAA
GFADGSVRIYDVRSPDRLVYVARPHAPRTEKVVGIGFQPGFDPYKIVSASQAGDIQFLDV
RRAAEPYLTIEAHRGSLTALAVHRHAPVVASGSAKQMIKVFSLEGEQLTIIRYQPSFMGQ
RIGSVNCLSFHPYKSLLAAGAGDNALVSIYAEENYK
NT seq 3711 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccggatgtgttgcacttgtattatgtttaaacataagtgttgatccacctgat
gtaattaaaatttccccttgtgcaagaatggagtgctggatagatcctttctctatgcta
gctcctaaagctcttgaaagtattggaaaaactttgcattctcagtatgagcgctggcaa
cctaaggctcgctacaagcttcagctggatccaacagtggaggaagttaagaagctttgt
aatacttgccgcaaatatgccagatcagagagagtccttttccattataacggccatggt
gtaccaaagcctacatctaatggtgagatttgggtgtttaacaagagctacacacagtat
attccacttccaattactgatcttgattcatggctgaagacaccttccatttacgttttt
gattgctcagcagctggaattattgtgaaagcttttctagagcgcctagactggagttct
acctcatctgcatcttcacagaaggattgcattcttcttgctgcctgcgaagcacatcaa
atgcttccccagagtgcagaatttcctgctgacgtgtttacggcttgcctcacaacgccc
atcaaaatggctttgcactggttttgtaagcgaacattactccatggttctctggatcat
tctcttattgaccaaattcctggacggcaaaatgaccgtaaaacacttcttggagagctc
aattggatttttactgctataacagatactatcgcatggaatgttctccctcatggtctg
ttccaaaggcttttcaggcaagaccttcttgttgctagtctcttccgtaacttcttgctt
gctgagagaatcatgcgatctgcaaactgttctccagtttcttatccaatgctaccccca
acacatcaacaccatatgtgggatgcatgggacatggctgctgagatttgcctttccaag
cttcctcagttaattgctgatccaaatgcagagtttcagccaagtccgttttttacggaa
caactgatggctttcgaagtgtggctcgatcatggctctgaggacaagaaacctcctgaa
cagttacctatagttcttcaggtcctgcttagtcaatcacatagatttagagcacttgtt
ctgcttggaagatttcttgacatgggaccatgggcagttgatttggccctgtctgtcgga
atatttccttatgtactcaaactactacaaacaagtgcaatggagttacgtcaaattcta
gtgtttatatggacaaaaattctctctcttgataagtcatgtcaggttgacttggttaaa
gatggagggcatggatattttattaggtttcttgacagtttggatgctttcccagaacag
cgtgcaatggctgcttttgttatagcagtcattgtggatgggcataggacgggtcaagag
gcttgtatgaatgccgggcttatagatgtttgcctgagacatctgcaacctgagaatcct
catgcacaaacagaacctttgcttttgcagtggctttgtttatgccttgggaaagtctgg
gaagatttccctgaggctcagttacatggtctgcaaacaaatgcaccagaaattgtaata
tgtttattgtcggagcctcaacctgaggtcagagctgctgctgtttttgcacttgggaat
ctccttgataatacgttaaatggctctgatgatgattctgatgatgatgaaaaggtgaaa
gctgaaataaatgtagttcgaagccttctgcagatgtcttcagatggtagtccccttgtt
agatctgaggttgctatagcgcttactcgctttgcatcgggtcacaacaaacatctcaaa
tctgttgctgcggagtactggaaacctcaatccaactcgttgctgaagtcactaccatca
ttggcaaatataagtaatccaagcaatgtttacagtcccaacaacagcattggtcctgtg
ctgagggttggcagtgatagcggtgccgctggtcgtgatggaagaatttctacaagtagc
ccaattgcaacaagtagcatcatgcatggctctccccaatcagatgattcttcccaacac
tctgattcaggtttattattgagggagaatgcaagtaatggtggtctcagctacactgcg
ccgaggcctgtcgataatgtcatttattctcaatttatatcaactatgtgttctatttct
aaagatcctgacccaagaattgcaactattggccggagagcactgtcccttatagatgtt
gaacaagtggtcatgaaaaatactagatttaacagtggaggtccacatcgggtagagaca
tctgcgtcaaactatggaatggcacgctcttcttcttggcgtgatatgaattctggaagc
atctcaatgaaatttatgacccctcctgtcagccctcctcagcatgattatcttatagga
ttacgccgagtgtgttctatggagtttggacagcatcctataaattcacctgatggctta
gctgatcgccttttaagctctgctgcgggcctcagtaatagagaaccacttccccaatca
acaatttacaactggagttgtggtcacttctctaggccacttttaaccgtctctgatgat
aatgaagaaaccaatgctagaagagaagagaaagaacgaattgcactagattacatcact
aagtgccagcgctcctcttgcaagatgacaagccaaattgctagttgggatacaaggttt
gagttgggaacaaaagcagctttattgttgccattttctccaatcgttgtcgcagctgat
gaaagtgaacaaataagagtgtggaactacgatgatgcactaccagtgaactcttttcaa
aaccataagttatccgacagagggctatctaaacttttgcttatcaatgagcttgatgag
agcttgcttttggccgcctcaagtgatggaaatgtacgtatatggaaaaattttgctcaa
aagggaggacagaaacttgtaactgctttctcatcagttcagggacaccgagctgctgga
cgcagtattgtgattgactggcagcagcaatctggttatctgtatgcatctggtgacatg
tcttccatcttggtatgggatcttgataaggaacaacttctcagcaccattcagtcaact
gctgataatgccatttcttccctgtctgcatctctggtccgctccggacactttgctgct
ggttttgctgatggttctgtcaggatatatgatgttcgctctcctgataggcttgtctat
gtggccaggccgcatgccccaagaacggaaaaggttgtgggcatagggtttcagcctggg
tttgatccatacaagattgtaagtgcatctcaagctggagacattcagtttcttgatgtt
agaagggccgcagaaccctacctgactattgaggcacacaggggttcacttacagcatta
gcggttcatcggcatgccccagttgttgctagtggctcagccaagcagatgattaaagtg
tttagtcttgaaggagagcagttgacgattattcgctaccagccatcttttatgggtcaa
agaataggcagtgtaaattgcctttcttttcacccatacaagtcactcctggctgctggt
gctggtgataatgctcttgtctctatctatgccgaggaaaattacaagtaa

DBGET integrated database retrieval system