KEGG   Sorghum bicolor (sorghum): SORBI_05g002750Help
Entry
SORBI_05g002750   CDS       T01086                                 

Gene name
SORBIDRAFT_05g002750, Sb05g002750
Definition
hypothetical protein
Orthology
K16818  
phospholipase A1 [EC:3.1.1.32]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycerophospholipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SORBI_05g002750 (SORBIDRAFT_05g002750)
   00592 alpha-Linolenic acid metabolism
    SORBI_05g002750 (SORBIDRAFT_05g002750)
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.32  phospholipase A1
     SORBI_05g002750 (SORBIDRAFT_05g002750)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 412 aa AA seqDB search
MAAAAASISGSRTCYPSGGVPMASGGRRRTVIRSSFAPGSPASTPSTVRIGSKWTELQGA
RDWDGLLSPLDGALRGELVRYGEFVRAAYASFDFEGGAPSYGSCRFPSRSLLRRAGMPGT
GYRVTRLLHAASSCTASLRWWLPSSSPPPCGSSYIGFVAVCDDEREIERLGRRDVVVAFR
GTATCGEWVDNFKSGLTRLPTIPTTMTGGGEDDGEEAMVERGFWRLFTAPGEAHSSLQQQ
VRDEARRIAHEYGGSGMPPLSITVTGHSLGAALAVLTAHEIATTQQQQQRQEDGEPAAMM
VTAVSFGGPRVGNAAFRRRMEESGGKVLRVVNSDDIVTKVPGFPVHEQGDGGDQPAKGMM
KARLPRWLVAKMGWAYADVGRELRLSQAGSPPNVVASHDLDLYLKLVASCTD
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcgtctatctccggatcccgcacctgctaccctagcggcggcgtc
ccaatggccagcggcggccggcggcgcaccgtcatcaggagctccttcgcgcccggctcg
ccggcgtcgacgccatcgacggtgcggatcggcagcaagtggacggagctccagggcgcg
cgggactgggacggcctgctgagcccgctggacggcgcgctccggggcgagctggtccgg
tacggggagttcgtgcgcgcggcgtacgccagcttcgacttcgagggcggcgcgccgtcc
tacggctcctgccggttcccgagccgctccctgctgcgccgcgcggggatgccggggacc
gggtaccgggtcacgcgcctcctccacgccgcgtcgtcgtgcaccgcgtcgctccggtgg
tggctaccctcgtcgtcgccgccgccgtgcgggtccagctacatcggcttcgtcgcggtg
tgcgacgacgagcgcgagatcgaacggctcggccgccgcgacgtcgtcgtcgcgttccgc
ggcaccgccacgtgcggcgagtgggtggacaacttcaagtccggcctcacacggctcccg
acgatcccgacgacgatgaccggcgggggggaggacgacggcgaggaggcgatggtggag
cgcgggttctggaggctcttcacggcgccaggcgaggcgcacagcagcctgcagcagcag
gtgcgcgacgaggcgcggcggatcgcccacgagtacggcggcagcggcatgccgccgctg
agcatcacggtgacggggcacagcctcggcgcggcgctcgcggtcctcaccgcccacgag
atcgcgacgacgcagcagcagcagcagcgacaggaagacggcgagccggcggcgatgatg
gtgacggccgtgtcgttcggcgggccgcgcgtgggcaacgcggcgttccggcggaggatg
gaggagagcggcggcaaggtgctccgcgtggtgaactcggacgacatcgtgaccaaggtg
ccggggttcccagtgcacgagcagggcgacggcggcgaccagccggcgaaggggatgatg
aaggcgaggctgccgaggtggctcgtcgccaagatggggtgggcgtacgccgacgtaggg
cgcgagctgcggctgagccaggccggctcgccgcccaacgtggtggcctcgcatgacctc
gacttgtacctcaagctcgtcgcttcctgcacagactag

DBGET integrated database retrieval system