KEGG   Sorghum bicolor (sorghum): SORBI_05g002750Help
Entry
SORBI_05g002750   CDS       T01086                                 

Gene name
SORBIDRAFT_05g002750, Sb05g002750
Definition
hypothetical protein
Orthology
K16818  
phospholipase A1 [EC:3.1.1.32]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycerophospholipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:sbi00564]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:sbi00592]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 412 aa AA seqDB search
MAAAAASISGSRTCYPSGGVPMASGGRRRTVIRSSFAPGSPASTPSTVRIGSKWTELQGA
RDWDGLLSPLDGALRGELVRYGEFVRAAYASFDFEGGAPSYGSCRFPSRSLLRRAGMPGT
GYRVTRLLHAASSCTASLRWWLPSSSPPPCGSSYIGFVAVCDDEREIERLGRRDVVVAFR
GTATCGEWVDNFKSGLTRLPTIPTTMTGGGEDDGEEAMVERGFWRLFTAPGEAHSSLQQQ
VRDEARRIAHEYGGSGMPPLSITVTGHSLGAALAVLTAHEIATTQQQQQRQEDGEPAAMM
VTAVSFGGPRVGNAAFRRRMEESGGKVLRVVNSDDIVTKVPGFPVHEQGDGGDQPAKGMM
KARLPRWLVAKMGWAYADVGRELRLSQAGSPPNVVASHDLDLYLKLVASCTD
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcgtctatctccggatcccgcacctgctaccctagcggcggcgtc
ccaatggccagcggcggccggcggcgcaccgtcatcaggagctccttcgcgcccggctcg
ccggcgtcgacgccatcgacggtgcggatcggcagcaagtggacggagctccagggcgcg
cgggactgggacggcctgctgagcccgctggacggcgcgctccggggcgagctggtccgg
tacggggagttcgtgcgcgcggcgtacgccagcttcgacttcgagggcggcgcgccgtcc
tacggctcctgccggttcccgagccgctccctgctgcgccgcgcggggatgccggggacc
gggtaccgggtcacgcgcctcctccacgccgcgtcgtcgtgcaccgcgtcgctccggtgg
tggctaccctcgtcgtcgccgccgccgtgcgggtccagctacatcggcttcgtcgcggtg
tgcgacgacgagcgcgagatcgaacggctcggccgccgcgacgtcgtcgtcgcgttccgc
ggcaccgccacgtgcggcgagtgggtggacaacttcaagtccggcctcacacggctcccg
acgatcccgacgacgatgaccggcgggggggaggacgacggcgaggaggcgatggtggag
cgcgggttctggaggctcttcacggcgccaggcgaggcgcacagcagcctgcagcagcag
gtgcgcgacgaggcgcggcggatcgcccacgagtacggcggcagcggcatgccgccgctg
agcatcacggtgacggggcacagcctcggcgcggcgctcgcggtcctcaccgcccacgag
atcgcgacgacgcagcagcagcagcagcgacaggaagacggcgagccggcggcgatgatg
gtgacggccgtgtcgttcggcgggccgcgcgtgggcaacgcggcgttccggcggaggatg
gaggagagcggcggcaaggtgctccgcgtggtgaactcggacgacatcgtgaccaaggtg
ccggggttcccagtgcacgagcagggcgacggcggcgaccagccggcgaaggggatgatg
aaggcgaggctgccgaggtggctcgtcgccaagatggggtgggcgtacgccgacgtaggg
cgcgagctgcggctgagccaggccggctcgccgcccaacgtggtggcctcgcatgacctc
gacttgtacctcaagctcgtcgcttcctgcacagactag

DBGET integrated database retrieval system