KEGG   Sorghum bicolor (sorghum): SORBI_05g006625Help
Entry
SORBI_05g006625   CDS       T01086                                 

Gene name
SORBIDRAFT_05g006625, Sb05g006625
Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SORBI_05g006625 (SORBIDRAFT_05g006625)
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SORBI_05g006625 (SORBIDRAFT_05g006625)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 117 aa AA seqDB search
EKHISKGRFLEFARVHGNVYGTGNEGVESVIDEGNRCILDINAQRTRSVRASSLQAIFIF
VPSAPLSFEEVEKRLWPRVTETQKHNQKRLRNARAELHQSNEPDLFNNLLVNGDFET
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
gagaaacatataagcaagggcagatttcttgagtttgcccgtgttcatggaaatgtatat
ggcacaggtaatgaaggagtcgaatctgttattgatgagggaaataggtgtattctcgac
attaatgcacaacgaactcgatccgtgagggcttcttctcttcaagcaatattcatcttt
gtaccctctgcccctctatcattcgaggaagtagagaagcgcctttggccacgagttact
gaaacacaaaagcacaaccagaaacgactcagaaatgctcgagctgaacttcatcagtcc
aatgaaccagatctcttcaataatcttttggtcaatggtgactttgagaca

DBGET integrated database retrieval system