KEGG   Sorghum bicolor (sorghum): SORBI_05g016730Help
Entry
SORBI_05g016730   CDS       T01086                                 

Gene name
SORBIDRAFT_05g016730, Sb05g016730
Definition
hypothetical protein
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sbi00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sbi00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:sbi00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 521 aa AA seqDB search
MAAAPANGDSQSGPQRNYQVVVAATRDMGIGKDGVLPWKLLGDLKFFKELTLTTSDPAKK
NAVIMGRKTWESIPVKSRPLPGRLNVILTRSGSFDFATVENVVICGSMNSALELLASTPY
CLSIEKVFVVGGGQVLREYLNGPACEAIHLTDIQSSIECDTFIPPVDFSVFQPWYSSFPV
VESNIRHSFVTFVRVRKSVAETHESNGKESTEVDTKNDKFEIENFSFLPEMVYDRHEEYQ
YLNLVEDIIRSGAQKNDRTGTGTMSKFGCQMRFNLRKNFPLLTTKRVFWRGVVEELLWFI
SGSTNAKVLQEKGIHIWDGNASREYLDSVGLAHREEGDLGPVYGFQWRHFGAEYTDMHAD
YTGKGFDQLMDVIDKIKNNPDDRRIIMSAWNPSDLKKMALPPCHMFAQFYVENGELSCQM
YQRSADMGLGVPFNIASYSLLTYMIAQVCDLSPGDFVHVIGDAHVYRTHVRALEEQIQKM
PKPFPILKINPSKKDIDSFMASDFKLVGYDPHQKIEMKMAV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagctccggccaatggtgattcacagagtggtcctcagaggaactaccaggtt
gttgttgctgccactcgtgacatgggcattgggaaggatggggttctgccatggaagctt
cttggtgatcttaaattcttcaaagagcttacactaactacatctgatcctgccaagaag
aatgcagttataatgggaaggaaaacatgggagagcattcctgttaagtcaaggccattg
cctggtcgtttgaatgtcatacttactcgatctggtagctttgattttgcaacagtagag
aatgttgttatatgtggaagtatgaattctgccttagaactgctagcatcaactccatac
tgcttatcaattgagaaagtttttgttgtaggaggtgggcaggtactgagagaatatctt
aatggacctgcttgtgaggctatccatctaactgacattcagtcgagcattgagtgtgac
actttcatccctccagttgacttctcagtgttccagccatggtattcatctttcccagtg
gtagagagcaacattaggcattcttttgtgacttttgttcgtgttagaaagtcagtggca
gaaactcatgagtcaaatggcaaggaatcaactgaggttgataccaagaatgacaaattt
gaaatagagaatttctcttttctccccgagatggtatatgaccgccatgaggagtatcaa
tatctcaatcttgttgaagatattataagatctggtgctcagaaaaatgacaggacagga
actggaacaatgtcaaaatttggatgtcagatgcggttcaacttaaggaaaaattttcct
ctgctgacaacaaagagggtattttggcgtggtgttgtcgaagaactcctttggttcatc
agtggctcaacaaatgcaaaggttttgcaagagaagggtattcacatctgggatggcaat
gcttcaagagagtatcttgacagtgttggcttggcacacagggaggaaggtgatctaggt
ccagtttatggatttcaatggcgtcactttggtgctgaatacactgacatgcatgctgac
tatactggaaaaggttttgatcagctaatggatgtgattgacaagatcaagaataatcct
gatgaccgccgaataattatgtctgcgtggaatccttcagatctcaagaagatggctctt
cctccttgccacatgtttgcacaattttatgttgaaaatggggagctatcctgccagatg
tatcaacgctctgcagacatggggcttggtgttccattcaacatcgcatcatattctctt
ctgacatacatgatcgctcaagtttgtgatctttctcctggagattttgtccatgttata
ggggatgctcatgtctatagaactcatgttcgagctctggaggagcaaattcagaagatg
cctaaaccatttccaattttgaagataaatccttcaaaaaaggatatagattctttcatg
gcatcagacttcaagctggttggctatgatcctcaccagaagatagagatgaaaatggca
gtgtaa

DBGET integrated database retrieval system