KEGG   Sorghum bicolor (sorghum): SORBI_05g020150Help
Entry
SORBI_05g020150   CDS       T01086                                 

Gene name
SORBIDRAFT_05g020150, Sb05g020150
Definition
hypothetical protein
Orthology
K00660  
chalcone synthase [EC:2.3.1.74]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Circadian rhythm - plant
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:sbi00941]
Organismal Systems; Environmental adaptation; Circadian rhythm - plant [PATH:sbi04712]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 401 aa AA seqDB search
MAAATVTVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKF
KRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKE
WGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKD
LAENNRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGADPDERVERPL
FQLVSASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERSLEEAFKPLGITDYN
SIFWVAHPGGPAILDQVEAKVGLEKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAED
GQATTGEGFDWGVLFGFGPGLTVETVVLHSVPITTGAAITA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcgactgtgaccgtcgaggaggtgaggaaggcgcagcgcgcgacgggcccg
gccaccgtgctggcgatcgggacggcgacgccggccaactgcgtgcaccaggccgactac
ccggactactacttccggatcacaaagagcgagcacatgaccgaactcaaggagaagttc
aagaggatgtgcgacaagtcgcagatccggaagcggtacatgcacctgacggaggagtac
ctggcggagaaccccaacatgtgcgcgtacatggcgccgtcgctggacgcccgccaggac
atcgtggtggtggaggtgcccaagctaggcaaggccgcggcgcagaaggcgatcaaggag
tgggggcagccgaaatccaagatcactcacctcgtcttctgcaccacctccggcgtcgac
atgccgggcgccgactaccagctcaccaagatgctgggcctgcggccctcggtcaaccgc
ctgatgatgtaccagcaggggtgcttcgcgggcggcacggtgctgcgcgtggccaaggac
ctcgccgagaacaaccgtggggcgcgcgtcctggtggtgtgctccgagatcaccgccgtc
acgttccgtggaccctccgagtcccacctcgactccatggttggccaagcgctgttcggc
gacggtgctgcggcggttattgtgggagctgaccctgacgagcgcgtggagcgcccgctg
ttccagctcgtgtcggcgtcgcagacaatcctgccggactccgagggcgccatcgacggc
cacctccgtgaggtcgggctcacgttccacctgctcaaggacgtgcccgggctcatctcc
aaaaacatagagcgctcgctggaggaggcgttcaagccgctggggatcaccgactacaac
tccatcttctgggtggcgcaccctggcgggccagcaatcctggaccaggtggaggccaag
gtcgggctagagaaggagcggatgcgtgccacgcgccatgtcctgtccgagtacggcaac
atgtctagtgcgtgcgtgctcttcatcctcgacgagatgcgcaaacgctccgccgaggac
ggccaggcaaccaccggcgaaggcttcgactggggcgtgctcttcggcttcggtcctggg
ctcaccgtcgagaccgtcgtgctccacagcgtccccatcaccaccggagcggccatcacc
gcgtga

DBGET integrated database retrieval system